Copy Link Print Information

IL-18 Protein, Mouse (solution)

5 Cited Publications
Customer Review

Based on 5 publication(s) in Google Scholar

IL-18 protein is a pro-inflammatory cytokine that plays an important role in epithelial barrier repair and immune response regulation by polarizing T helper 1 (Th1) cells and natural killer (NK) cells. After binding to IL18R1 and IL18RAP receptors, IL-18 forms a signaling ternary complex, activates NF-κ-B, and induces inflammatory mediators. IL-18 Protein, Mouse (solution) is the recombinant mouse-derived IL-18 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for IL-18 Protein, Mouse (solution)
  • Experimental Validation Results for IL-18 Protein, Mouse (solution)
  • Experimental Validation Results for IL-18 Protein, Mouse (solution)
  • Experimental Validation Results for IL-18 Protein, Mouse (solution)
  • Experimental Validation Results for IL-18 Protein, Mouse (solution)
  • Experimental Validation Results for IL-18 Protein, Mouse (solution)
  • Experimental Validation Results for IL-18 Protein, Mouse (solution)
  • Experimental Validation Results for IL-18 Protein, Mouse (solution)
  • IL-18 Protein, Mouse (solution) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-18 protein is a pro-inflammatory cytokine that plays an important role in epithelial barrier repair and immune response regulation by polarizing T helper 1 (Th1) cells and natural killer (NK) cells. After binding to IL18R1 and IL18RAP receptors, IL-18 forms a signaling ternary complex, activates NF-κ-B, and induces inflammatory mediators. IL-18 Protein, Mouse (solution) is the recombinant mouse-derived IL-18 protein, expressed by E. coli , with tag free.

Background

IL-18 Protein is a pro-inflammatory cytokine that plays a crucial role in epithelial barrier repair and the modulation of immune responses by polarizing T-helper 1 (Th1) cells and natural killer (NK) cells. Upon binding to its receptors IL18R1 and IL18RAP, IL-18 forms a signaling ternary complex that activates NF-kappa-B, leading to the synthesis of inflammatory mediators. It synergizes with IL-12/interleukin-12 to induce the synthesis of IFNG from Th1 cells and NK cells. IL-18 is also involved in transducing inflammation downstream of pyroptosis, where its mature form is specifically released into the extracellular space through the gasdermin-D (GSDMD) pore. At the plasma membrane, IL-18 forms a ternary complex with IL18R1 and IL18RAP, with IL18 first binding to IL18R1 to form a low affinity binary complex, which then interacts with IL18RAP to form a high affinity ternary complex that signals within the cell. Additionally, IL-18 interacts with the cargo receptor TMED10 to facilitate its translocation from the cytoplasm to the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) for secretion.

Verified Bioactivity

Measured by its ability to induce IFN-γ secretion by KG-1 human myelomonocyte and the ED50 is typically 0.1-0.8 μg/mL.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession

    P70380 (N36-S192)

  • Gene ID
    16173  [NCBI]
  • Molecular Construction
    • N-term
    • IL-18 (N36-S192)
      Accession # P70380
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL18; Interleukin 18 (Interferon-Gamma-Inducing Factor); Interleukin 18; IFN-Gamma-Inducing Factor; IL-18; Interleukin-1 Gamma; IL1F4; Iboctadekin; IGIF; IL-1 Gamma; Interleukin-18; Interferon-Gamma-Inducing Factor; IL-1g; Interferon Gamma-Inducing Factor

  • AA Sequence

    NFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS

  • Predicted Molecular Mass

    18.2 kDa

  • Molecular Weight

    Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to induce IFN-gamma secretion by KG‑1 human acute myelogenous leukemia cells. The ED50 for this effect is 0.1519 μg/mL, corresponding to a specific activity is 6.583×103 U/mg.

  • 1/16

    IL-18 Protein, Mouse (solution) purchased from MedChemExpress. Usage Cited in: Sci Rep. 2026 Feb 6;16(1):7540. [Abstract]

    Customer Validation
     PSCs were treated with rmIL-18 (IL-18 Protein; 100 ng/mL; 24 h; HY-P73181), and qPCR was used to detect changes in the expression of IL-4, α-SMA, and TGF-β1 (n = 5).

  • 1/16

    IL-18 Protein, Mouse (solution) purchased from MedChemExpress. Usage Cited in: Sci Rep. 2026 Feb 6;16(1):7540. [Abstract]

    Customer Validation
     ELISA was used to measure changes in the IL-4 protein levels in the culture supernatant of PSCs treated with rmIL-18 (IL-18 Protein; 100 ng/mL; 24 h; HY-P73181) (n = 3).

  • 1/16

    IL-18 Protein, Mouse (solution) purchased from MedChemExpress. Usage Cited in: Sci Rep. 2026 Feb 6;16(1):7540. [Abstract]

    Customer Validation
     Western blot results of macrophages after intervention (n = 3). The Western blot results showed that rmIL-18 (IL-18 Protein; 100 ng/mL; 24 h; HY-P73181) alone was unable to directly induce M2 polarization in macrophages, whereas conditioned media from rmIL-18-treated PSCs significantly promoted macrophage M2 polarization. In contrast, this phenotypic effect was markedly suppressed by IL-4 neutralization.

  • 1/16

    IL-18 Protein, Mouse (solution) purchased from MedChemExpress. Usage Cited in: Sci Rep. 2026 Feb 6;16(1):7540. [Abstract]

    Customer Validation
     WT mice with caerulein-induced CP received (IL-18 Protein; 500 ng /mouse; i.p.; three times a week; HY-P73181) with or without IL-4 neutralizing antibody. Pancreatic IL-4 assessed by IF (n = 3–5). Scale bar = 30 μm.

  • 1/16

    IL-18 Protein, Mouse (solution) purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2025 Feb 6:147:114016. [Abstract]

    Customer Validation
     Mice were treated with IL18BP (500 μg/kg, i.p.), anakinra (2.5 mg/kg, i.p.) or IL-18 (IL-18 Protein, 20 ng per mouse; i.p.; once daily for 5 days; HY-P73181) 2 h before doxorubicin administration. Kaplan Meier survival analysis showed the survival rate (n = 10).

  • 1/16

    IL-18 Protein, Mouse (solution) purchased from MedChemExpress. Usage Cited in: Cancer Immunol Res. 2022 Dec 2;10(12):1542-1558. [Abstract]

    Customer Validation
     IL-18 Protein (20 ng per mouse, i.p.; HY-P73181) was administered one day before L-OHP administration to Nlrp3−/− mice until the end of 7 days. The mechanical pain threshold was measured for 7 days (n = 6). The results showed that administration of IL-18 Protein to Nlrp3−/− mice elicited mechanical hyperalgesia.

  • IL-18 Protein, Mouse (solution) Product Image
    1/16
  • Experimental Validation Results for IL-18 Protein, Mouse (solution)
  • Experimental Validation Results for IL-18 Protein, Mouse (solution)
  • Experimental Validation Results for IL-18 Protein, Mouse (solution)
  • Experimental Validation Results for IL-18 Protein, Mouse (solution)
  • Experimental Validation Results for IL-18 Protein, Mouse (solution)
  • Experimental Validation Results for IL-18 Protein, Mouse (solution)
  • Experimental Validation Results for IL-18 Protein, Mouse (solution)
  • Experimental Validation Results for IL-18 Protein, Mouse (solution)
  • IL-18 Protein, Mouse (solution) Product Image

  • IL-18 Protein, Mouse (solution) purchased from MedChemExpress. Usage Cited in: Sci Rep. 2026 Feb 6;16(1):7540. [Abstract]

    PSCs were treated with rmIL-18 (IL-18 Protein; 100 ng/mL; 24 h; HY-P73181), and qPCR was used to detect changes in the expression of IL-4, α-SMA, and TGF-β1 (n = 5).

  • IL-18 Protein, Mouse (solution) purchased from MedChemExpress. Usage Cited in: Sci Rep. 2026 Feb 6;16(1):7540. [Abstract]

    ELISA was used to measure changes in the IL-4 protein levels in the culture supernatant of PSCs treated with rmIL-18 (IL-18 Protein; 100 ng/mL; 24 h; HY-P73181) (n = 3).

  • IL-18 Protein, Mouse (solution) purchased from MedChemExpress. Usage Cited in: Sci Rep. 2026 Feb 6;16(1):7540. [Abstract]

    Western blot results of macrophages after intervention (n = 3). The Western blot results showed that rmIL-18 (IL-18 Protein; 100 ng/mL; 24 h; HY-P73181) alone was unable to directly induce M2 polarization in macrophages, whereas conditioned media from rmIL-18-treated PSCs significantly promoted macrophage M2 polarization. In contrast, this phenotypic effect was markedly suppressed by IL-4 neutralization.

  • IL-18 Protein, Mouse (solution) purchased from MedChemExpress. Usage Cited in: Sci Rep. 2026 Feb 6;16(1):7540. [Abstract]

    WT mice with caerulein-induced CP received (IL-18 Protein; 500 ng /mouse; i.p.; three times a week; HY-P73181) with or without IL-4 neutralizing antibody. Pancreatic IL-4 assessed by IF (n = 3–5). Scale bar = 30 μm.

  • IL-18 Protein, Mouse (solution) purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2025 Feb 6:147:114016. [Abstract]

    Mice were treated with IL18BP (500 μg/kg, i.p.), anakinra (2.5 mg/kg, i.p.) or IL-18 (IL-18 Protein, 20 ng per mouse; i.p.; once daily for 5 days; HY-P73181) 2 h before doxorubicin administration. Kaplan Meier survival analysis showed the survival rate (n = 10).

  • IL-18 Protein, Mouse (solution) purchased from MedChemExpress. Usage Cited in: Cancer Immunol Res. 2022 Dec 2;10(12):1542-1558. [Abstract]

    IL-18 Protein (20 ng per mouse, i.p.; HY-P73181) was administered one day before L-OHP administration to Nlrp3−/− mice until the end of 7 days. The mechanical pain threshold was measured for 7 days (n = 6). The results showed that administration of IL-18 Protein to Nlrp3−/− mice elicited mechanical hyperalgesia.