IL-18BP Protein, Cynomolgus (HEK293, His)
Based on 1 Customer Validation
The IL-18BP protein is an inhibitor of IL-18, which binds to IL-18 and prevents IL-18 from binding to its receptor, thereby inhibiting IL-18-induced IFN-γ production. IL-18BP protein is constitutively expressed and secreted in monocytes. IFN-γ can enhance the expression of this protein. IL-18BP Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived IL-18BP protein, expressed by HEK293 , with C-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The IL-18BP protein is an inhibitor of IL-18, which binds to IL-18 and prevents IL-18 from binding to its receptor, thereby inhibiting IL-18-induced IFN-γ production. IL-18BP protein is constitutively expressed and secreted in monocytes. IFN-γ can enhance the expression of this protein. IL-18BP Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived IL-18BP protein, expressed by HEK293 , with C-His labeled tag.
Background
Interleukin-18 is an interferon (IFN-γ) inducer and a member of the interleukin-1 (IL-1) cytokine family. IL-1 cytokines and their receptors are involved in inflammation, fever, and immune stimulation. IL-18 binding protein is an inhibitor of IL-18, which binds to IL-18 and prevents IL-18 from binding to its receptor, thereby inhibiting IL-18-induced IFN-γ production. IL-18 binding protein is constitutively expressed and secreted in monocytes. IFN-γ can enhance the expression of this protein[1][2].
Verified Bioactivity
Immobilized Human IL-18, No Tag at 1 μg/mL (100 μL/well) on the plate. Dose response curve for Cynomolgus IL-18BP, His Tag with the EC50 of 1.0-10.0 ng/mL determined by ELISA.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-8*His
-
Accession
A0A2K5UDJ4 (T28-P207)
-
Molecular Construction
-
N-term
-
IL-18BP (T28-P207)
Accession # A0A2K5UDJ4 -
8*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL18BP; MC51L-53L-54L Homolog Gene Product; Interleukin 18 Binding Protein; Tadekinig-Alfa; Interleukin-18-Binding Protein; IL-18BP; IL18BPa; FVH
-
AA Sequence
TPVSQTTTAATASSRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEMPLNGTLTLSCTACSRFPNFSMLYWLGNGSFIEHLPGQLWEGSTSREHGSTGTRLYKALVLEQLTPALHSTNFSCVLMDPEQVVQRHVILAQLWAGLRTTLPPTQEALPSSHSTGPQQPTAAGLRLSTGPAAARP
-
Predicted Molecular Mass
21.1 kDa
-
Molecular Weight
Approximately 50-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
