IL-3 Protein, Cynomolgus (HEK293, His)

IL-3 Protein, secreted by T-lymphocytes, mast cells, and osteoblastic cells, regulates hematopoiesis and activates basophils, eosinophils, and monocytes. It promotes neural cell proliferation, inhibits osteoclast differentiation, and activates JAK2-STAT5 signaling. IL-3 also activates PI3K/AKT and ERK pathways for cell survival during oxidative stress. IL-3 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived IL-3 protein, expressed by HEK293, with C-His labeled tag.

IL-3 Protein is a cytokine primarily secreted by activated T-lymphocytes, mast cells, and osteoblastic cells, and it plays a vital role in regulating hematopoietic progenitor cell production and differentiation into specific cell lineages. Additionally, IL-3 stimulates the functional activation of mature basophils, eosinophils, and monocytes. It also has important functions in neural cell proliferation and survival, and it participates in maintaining bone homeostasis by inhibiting osteoclast differentiation through the prevention of NF-kappa-B nuclear translocation and activation. The biological effects of IL-3 are mediated through a receptor complex composed of the IL3RA subunit and the IL3RB signal transducing subunit, which leads to the rapid activation of JAK2 kinase activity and subsequent STAT5-mediated transcriptional programming. Furthermore, in non-hematopoietic systems, IL-3 contributes to cell survival during oxidative stress by activating pathways involving PI3K/AKT and ERK.

Cynomolgus

HEK293

C-His

G7P877 (A20-Q143)

/

Full Length of Interleukin-3

APMTQTTSLKTSWAKCSNMIDEIITHLNQPPLPSPDFNNLNEEDQTILVEKNLRRSNLEAFSKAVKSLQNTSAIESILKNLPPCLPMATAAPTRPPIRITNGDRNDFRRKLKFYLKTLENEQAQ

Approximately 18-27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.