IL-3 Protein, Cynomolgus (HEK293, His)
IL-3 Protein, secreted by T-lymphocytes, mast cells, and osteoblastic cells, regulates hematopoiesis and activates basophils, eosinophils, and monocytes. It promotes neural cell proliferation, inhibits osteoclast differentiation, and activates JAK2-STAT5 signaling. IL-3 also activates PI3K/AKT and ERK pathways for cell survival during oxidative stress. IL-3 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived IL-3 protein, expressed by HEK293, with C-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IL-3 Protein, secreted by T-lymphocytes, mast cells, and osteoblastic cells, regulates hematopoiesis and activates basophils, eosinophils, and monocytes. It promotes neural cell proliferation, inhibits osteoclast differentiation, and activates JAK2-STAT5 signaling. IL-3 also activates PI3K/AKT and ERK pathways for cell survival during oxidative stress. IL-3 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived IL-3 protein, expressed by HEK293, with C-His labeled tag.
Background
IL-3 Protein is a cytokine primarily secreted by activated T-lymphocytes, mast cells, and osteoblastic cells, and it plays a vital role in regulating hematopoietic progenitor cell production and differentiation into specific cell lineages. Additionally, IL-3 stimulates the functional activation of mature basophils, eosinophils, and monocytes. It also has important functions in neural cell proliferation and survival, and it participates in maintaining bone homeostasis by inhibiting osteoclast differentiation through the prevention of NF-kappa-B nuclear translocation and activation. The biological effects of IL-3 are mediated through a receptor complex composed of the IL3RA subunit and the IL3RB signal transducing subunit, which leads to the rapid activation of JAK2 kinase activity and subsequent STAT5-mediated transcriptional programming. Furthermore, in non-hematopoietic systems, IL-3 contributes to cell survival during oxidative stress by activating pathways involving PI3K/AKT and ERK.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-His
-
Accession
G7P877 (A20-Q143)
-
Gene ID/
-
Molecular Construction
-
N-term
-
IL-3 (A20-Q143)
Accession # G7P877 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL3; Colony-Stimulating Factor, Multiple; Interleukin 3; P-Cell Stimulating Factor; IL-3; P-Cell-Stimulating Factor; Hematopoietic Growth Factor; Mast-Cell Growth Factor; MCGF; Mast Cell Growth Factor; Multipotential Colony-Stimulating Factor; MGC79398; I
-
AA Sequence
APMTQTTSLKTSWAKCSNMIDEIITHLNQPPLPSPDFNNLNEEDQTILVEKNLRRSNLEAFSKAVKSLQNTSAIESILKNLPPCLPMATAAPTRPPIRITNGDRNDFRRKLKFYLKTLENEQAQ
-
Predicted Molecular Mass
15.9 kDa
-
Molecular Weight
Approximately 18-27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
