IL-9 Protein, Mouse (HEK293, Fc)

IL-9 is secreted by T helper 2 lymphocytes, mast cells, and NKT cells and plays an important role in antiparasitic immune responses, affecting intestinal permeability, adaptive immunity, and T cell subset differentiation.It promotes TH17 cell and mast cell proliferation through IL9R and IL2RG receptor activation, triggering JAK1 and JAK3 kinases and subsequent STAT-mediated transcription.IL-9 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IL-9 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IL-9 is secreted by T helper 2 lymphocytes, mast cells, and NKT cells and plays an important role in antiparasitic immune responses, affecting intestinal permeability, adaptive immunity, and T cell subset differentiation.It promotes TH17 cell and mast cell proliferation through IL9R and IL2RG receptor activation, triggering JAK1 and JAK3 kinases and subsequent STAT-mediated transcription.IL-9 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IL-9 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

IL-9, a multifunctional cytokine primarily secreted by T-helper 2 lymphocytes and also by mast cells or NKT cells, assumes crucial roles in the immune response against parasites. Beyond its anti-parasitic function, IL-9 influences intestinal epithelial permeability and adaptive immunity. It plays a pivotal role in inducing the differentiation of specific T-cell subsets, such as IL-17-producing helper T-cells (TH17), and promotes the proliferation and differentiation of mast cells. Mechanistically, IL-9 exerts its diverse biological effects through a receptor comprised of the IL9R subunit and the signal transducing subunit IL2RG. Stimulation of this receptor leads to rapid activation of JAK1 and JAK3 kinase activities, initiating STAT1, STAT3, and STAT5-mediated transcriptional programs. The induction of differentiation genes appears to be mediated by STAT1 alone, while the protection of cells from apoptosis depends on the concerted actions of STAT3 and STAT5. IL-9 interacts directly with IL9R and IL2RG, orchestrating a sophisticated network of interactions to modulate immune responses and cellular processes.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-9 (Q19-P144)
      Accession # P15247
    • hFc
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL9; Homolog Of Mouse T Cell And Mast Cell Growth Factor 40; Interleukin 9; P40 T-Cell And Mast Cell Growth Factor; IL-9; Interleukin-9; T-Cell Growth Factor P40; P40 Cytokine; HP40; Cytokine P40; P40

  • AA Sequence

    QRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP

  • Predicted Molecular Mass

    40.9 kDa

  • Molecular Weight

    Approximately 50-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00