IMPDH1 Protein, Human
IMPDH1 Protein, Human is the recombinant human-derived IMPDH1, expressed by E. coli , with tag Free labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IMPDH1 Protein, Human is the recombinant human-derived IMPDH1, expressed by E. coli , with tag Free labeled tag. ,
Background
IMPDH1 catalyzes the conversion of inosine 5'-phosphate (IMP) to xanthosine 5'-phosphate (XMP), the first committed and rate-limiting step in the de novo synthesis of guanine nucleotides, thus playing a key role in regulating cell growth. It may also possess single-stranded nucleic acid-binding activity and could be involved in RNA and/or DNA metabolism. Additionally, IMPDH1 might contribute to malignancy development and tumor progression. by similar: This description is inferred from the functions of similar proteins.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P20839-1 (M1-Y514)
-
Gene ID3614
-
Protein Length
Full Length of Isoform-1
-
Synonyms
IMPDH1; IMPD 1; Prev. RP10; IMPD; SWSS2608; Retinitis Pigmentosa 10 (Autosomal Dominant); LCA11; IMP (Inosine Monophosphate) Dehydrogenase 1; IMP (Inosine 5'-Monophosphate) Dehydrogenase 1; Inosine-5'-Monophosphate Dehydrogenase; Inosine-5'-Monophosphate
-
AA Sequence
MADYLISGGTGYVPEDGLTAQQLFASADGLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKKFEQGFITDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIGGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPIIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLRSMMYSGELKFEKRTMSAQIEGGVHGLHSYEKRLY
-
Predicted Molecular Mass
55.6 kDa
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
