Kremen-2 Protein, Human (Biotinylated, HEK293, His-Avi)
Kremen-2 protein is a receptor for Dickkopf protein and cooperates with DKK1/2 to inhibit Wnt/β-catenin signaling by promoting the endocytosis of Wnt receptors LRP5 and LRP6. Kremen-2 is positioned as a key regulator in the Wnt signaling pathway, regulating cellular responses to developmental cues. Kremen-2, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived Kremen-2 protein, expressed by HEK293, with N-Avi labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Kremen-2 protein is a receptor for Dickkopf protein and cooperates with DKK1/2 to inhibit Wnt/β-catenin signaling by promoting the endocytosis of Wnt receptors LRP5 and LRP6. Kremen-2 is positioned as a key regulator in the Wnt signaling pathway, regulating cellular responses to developmental cues. Kremen-2, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived Kremen-2 protein, expressed by HEK293, with N-Avi labeled tag.
Background
Kremen-2 Protein serves as a receptor for Dickkopf proteins and collaborates with DKK1/2 to inhibit Wnt/beta-catenin signaling by facilitating the endocytosis of Wnt receptors LRP5 and LRP6. This regulatory role in the Wnt signaling pathway positions Kremen-2 as a key modulator of cellular responses to developmental cues. In limb development, Kremen-2 plays a crucial role by attenuating Wnt signaling, contributing to normal limb patterning, and negatively regulating bone formation. Its interaction with ERLEC1 and formation of a ternary complex with DKK1 and LRP6 underscore the intricate molecular mechanisms through which Kremen-2 participates in the fine-tuning of Wnt signaling and developmental processes.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-His
-
Accession
Q8NCW0-1 (C219-L326)
-
Gene ID79412
-
Molecular Construction
-
N-term
-
Kremen-2 (C219-L326)
Accession # Q8NCW0-1 -
His-Avi
-
C-term
-
-
Protein Length
Full Length of CUB Domain
-
Conjugation
Biotin
-
Synonyms
KREMEN2; Kringle Domain-Containing Transmembrane Protein 2; Kringle Containing Transmembrane Protein 2; Dickkopf Receptor 2; KRM2; Kremen Protein 2; Kringle-Containing Protein Marking The Eye And The Nose; MGC10791
-
AA Sequence
CQGNWTAPQGVIYSPDFPDEYGPDRNCSWALGPPGAALELTFRLFELADPRDRLELRDAASGSLLRAFDGARPPPSGPLRLGTAALLLTFRSDARGHAQGFALTYRGL
-
Predicted Molecular Mass
18.5 kDa
-
Molecular Weight
Approximately 27-33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
