LDLR Protein, Human (HEK293, Fc)
LDLR Protein plays a pivotal role in cholesterol homeostasis, binding to LDL and mediating cellular uptake through endocytosis. Clustering into clathrin-coated pits is essential for internalization. In microbial infection, LDLR acts as a receptor for hepatitis C virus in hepatocytes, emphasizing its dual functionality in cholesterol metabolism and the cellular response to viral infections. LDLR Protein, Human (HEK293, Fc) is the recombinant human-derived LDLR protein, expressed by HEK293, with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
LDLR Protein plays a pivotal role in cholesterol homeostasis, binding to LDL and mediating cellular uptake through endocytosis. Clustering into clathrin-coated pits is essential for internalization. In microbial infection, LDLR acts as a receptor for hepatitis C virus in hepatocytes, emphasizing its dual functionality in cholesterol metabolism and the cellular response to viral infections. LDLR Protein, Human (HEK293, Fc) is the recombinant human-derived LDLR protein, expressed by HEK293, with C-hFc labeled tag.
Background
The LDLR Protein serves as a crucial mediator in cholesterol homeostasis by binding to low-density lipoprotein (LDL), the primary cholesterol-carrying lipoprotein in plasma, and facilitating its cellular uptake through endocytosis. To enable internalization, receptor-ligand complexes must first cluster into clathrin-coated pits. Additionally, in the context of microbial infection, LDLR acts as a receptor for the hepatitis C virus within hepatocytes, although this interaction does not occur through a direct binding with viral proteins. This dual functionality underscores the diverse roles of LDLR in both cholesterol metabolism and the cellular response to viral infections.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
P01130-1 (A22-R788)
-
Gene ID3949
-
Molecular Construction
-
N-term
-
LDLR (A22-R788)
Accession # P01130-1 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
LDLR; LDL Receptor; Low Density Lipoprotein Receptor; Low-Density Lipoprotein Receptor Class A Domain-Containing Protein 3; Low-Density Lipoprotein Receptor; Familial Hypercholesterolemia; LDLCQ2; Low Density Lipoprotein
-
AA Sequence
AVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAAVATQETSTVRLKVSSTAVRTQHTTTRPVPDTSRLPGATPGLTTVEIVTMSHQALGDVAGRGNEKKPSSVR
-
Predicted Molecular Mass
111.2 kDa
-
Molecular Weight
Approximately 120-125 kDa & 140-150 kDa under reduced (R) conditions, 270-330 kDa under non reducing (N) conditions, based on SDS-PAGE, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)