1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. MIF Protein, Human

MIF Protein, Human has assumed an important role as a pivotal regulator of innate immunity. MIF Protein, Human promotes the pro-inflammatory functions of immune cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

    MIF Protein, Human purchased from MCE. Usage Cited in: Mol Med. 2024 Nov 29;30(1):237.  [Abstract]

    rhMIF (MIF Protein, Human: 200 ng/mL) was incubated with PBMCs from RA patients for 6 hours, CD4+ T cells were sorted, and protein lysate was extracted for Western blot experiments.

    MIF Protein, Human purchased from MCE. Usage Cited in: Mol Med. 2024 Nov 29;30(1):237.  [Abstract]

    rhMIF (MIF Protein, Human: 200 ng/mL) was incubated with PBMCs from RA patients for 3 days, and the proportion of Th17 cells in the control and treatment groups was analyzed by flow cytometry.

    MIF Protein, Human purchased from MCE. Usage Cited in: Commun Biol. 2025 Jul 28;8(1):1112.  [Abstract]

    Cell viability of different groups of cells after adding rMIF (MIF Protein, Human: 100 ng/mL) at different time points.

    MIF Protein, Human purchased from MCE. Usage Cited in: Commun Biol. 2025 Jul 28;8(1):1112.  [Abstract]

    rMIF (MIF Protein, Human: 100 ng/mL). Representative micrographs of C11 BODIPY immunofluorescence staining in HK-2 cells after MIF upregulation and downregulation.

    MIF Protein, Human purchased from MCE. Usage Cited in: Commun Biol. 2025 Jul 28;8(1):1112.  [Abstract]

    Western blot results of P-AMPK and GPX4 in HK-2 cells after 6 hours of hypoxia following the addition of rMIF (MIF Protein, Human: 100 ng/mL).
    • Biological Activity

    • Technical Parameters

    • Properties

    • Documentation

    • References

    Description

    MIF Protein, Human has assumed an important role as a pivotal regulator of innate immunity. MIF Protein, Human promotes the pro-inflammatory functions of immune cells.

    Background

    Macrophage Migration Inhibitory Factor (MIF) has assumed an important role as a pivotal regulator of innate immunity. MIF is an integral component of the host antimicrobial alarm system and stress response that promotes the pro-inflammatory functions of immune cells. MIF-directed therapies might offer new treatment opportunities for human diseases in the future[1].

    Biological Activity

    Measured by its ability to inhibit THP-1 human acute monocyte migration .The ED50 this effect is ≤19.31 ng/mL, corresponding to a specific activity is ≥5.179×104 U/mg.

    • Measured by its ability to inhibit THP-1 human acute monocyte migration .The ED50 for this effect is 9.997 ng/mL, corresponding to a specific activity is 1.0×105 U/mg.
    Species

    Human

    Source

    E. coli

    Tag

    Tag Free

    Accession

    P14174 (M1-A115)

    Gene ID
    Molecular Construction
    N-term
    MIF (M1-A115)
    Accession # P14174
    C-term
    Protein Length

    Full Length

    Synonyms
    rHuMMIF; GLIF; MMIF; MIF
    AA Sequence

    MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

    Predicted Molecular Mass
    12.5 kDa
    Molecular Weight

    Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

    Purity
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    Lyophilized after extensive dialysis against PBS, pH 7.4.

    Endotoxin Level

    <0.2 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Documentation
    References

    MIF Protein, Human Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    MIF Protein, Human

     

    Requested Quantity *

    Applicant Name *

     

    Salutation

    Email Address *

     

    Phone Number *

    Department

     

    Organization Name *

    City

    State

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    MIF Protein, Human
    Cat. No.:
    HY-P7387
    Quantity:
    MCE Japan Authorized Agent: