Copy Link Print Information

MIF Protein, Human

10 Cited Publications
Customer Review

Based on 10 publication(s) in Google Scholar

MIF Protein, Human has assumed an important role as a pivotal regulator of innate immunity. MIF Protein, Human promotes the pro-inflammatory functions of immune cells.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for MIF Protein, Human
  • Experimental Validation Results for MIF Protein, Human
  • Experimental Validation Results for MIF Protein, Human
  • Experimental Validation Results for MIF Protein, Human
  • Experimental Validation Results for MIF Protein, Human
  • Experimental Validation Results for MIF Protein, Human
  • Experimental Validation Results for MIF Protein, Human
  • MIF Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

MIF Protein, Human has assumed an important role as a pivotal regulator of innate immunity. MIF Protein, Human promotes the pro-inflammatory functions of immune cells.

Background

Macrophage Migration Inhibitory Factor (MIF) has assumed an important role as a pivotal regulator of innate immunity. MIF is an integral component of the host antimicrobial alarm system and stress response that promotes the pro-inflammatory functions of immune cells. MIF-directed therapies might offer new treatment opportunities for human diseases in the future[1].

Verified Bioactivity

Measured by its ability to inhibit THP-1 human acute monocyte migration .The ED50 this effect is ≤19.31 ng/mL, corresponding to a specific activity is ≥5.179×104 U/mg.

Results
  • Experimental Validation Results for MIF Protein, Human
    Measured by its ability to inhibit THP-1 human acute monocyte migration .The ED50 for this effect is 9.997 ng/mL, corresponding to a specific activity is 1.0×105 U/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P14174 (M1-A115)

  • Gene ID
    4282  [NCBI]
  • Molecular Construction
    • N-term
    • MIF (M1-A115)
      Accession # P14174
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    rHuMMIF; GLIF; MMIF; MIF

  • AA Sequence

    MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

  • Predicted Molecular Mass

    12.5 kDa

  • Molecular Weight

    Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

    • Experimental Validation Results for MIF Protein, Human
      ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against PBS, pH 7.4.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Calandra T, et al. Macrophage migration inhibitory factor: a regulator of innate immunity. Nat Rev Immunol. 2003 Oct;3(10):791-800. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

  • ≥ 95%, as determined by reducing SDS-PAGE.

  • Measured by its ability to inhibit THP-1 human acute monocyte migration .The ED50 for this effect is 9.997 ng/mL, corresponding to a specific activity is 1.0×105 U/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to inhibit THP-1 human acute monocyte migration .The ED50 for this effect is 9.997 ng/mL, corresponding to a specific activity is 1.0×105 U/mg.

  • 1/16

    MIF Protein, Human purchased from MedChemExpress. Usage Cited in: Commun Biol. 2025 Jul 28;8(1):1112. [Abstract]

    Customer Validation
     Cell viability of different groups of cells after adding rMIF (MIF Protein, Human: 100 ng/mL) at different time points.

  • 1/16

    MIF Protein, Human purchased from MedChemExpress. Usage Cited in: Commun Biol. 2025 Jul 28;8(1):1112. [Abstract]

    Customer Validation
     rMIF (MIF Protein, Human: 100 ng/mL). Representative micrographs of C11 BODIPY immunofluorescence staining in HK-2 cells after MIF upregulation and downregulation.

  • 1/16

    MIF Protein, Human purchased from MedChemExpress. Usage Cited in: Commun Biol. 2025 Jul 28;8(1):1112. [Abstract]

    Customer Validation
     Western blot results of P-AMPK and GPX4 in HK-2 cells after 6 hours of hypoxia following the addition of rMIF (MIF Protein, Human: 100 ng/mL).

  • 1/16

    MIF Protein, Human purchased from MedChemExpress. Usage Cited in: Mol Med. 2024 Nov 29;30(1):237. [Abstract]

    Customer Validation
     rhMIF (MIF Protein, Human: 200 ng/mL) was incubated with PBMCs from RA patients for 6 hours, CD4+ T cells were sorted, and protein lysate was extracted for Western blot experiments.

  • 1/16

    MIF Protein, Human purchased from MedChemExpress. Usage Cited in: Mol Med. 2024 Nov 29;30(1):237. [Abstract]

    Customer Validation
     rhMIF (MIF Protein, Human: 200 ng/mL) was incubated with PBMCs from RA patients for 3 days, and the proportion of Th17 cells in the control and treatment groups was analyzed by flow cytometry.

  • MIF Protein, Human Product Image
    1/16
  • Experimental Validation Results for MIF Protein, Human
  • Experimental Validation Results for MIF Protein, Human
  • Experimental Validation Results for MIF Protein, Human
  • Experimental Validation Results for MIF Protein, Human
  • Experimental Validation Results for MIF Protein, Human
  • Experimental Validation Results for MIF Protein, Human
  • Experimental Validation Results for MIF Protein, Human
  • MIF Protein, Human Product Image

  • MIF Protein, Human purchased from MedChemExpress. Usage Cited in: Commun Biol. 2025 Jul 28;8(1):1112. [Abstract]

    Cell viability of different groups of cells after adding rMIF (MIF Protein, Human: 100 ng/mL) at different time points.

  • MIF Protein, Human purchased from MedChemExpress. Usage Cited in: Commun Biol. 2025 Jul 28;8(1):1112. [Abstract]

    rMIF (MIF Protein, Human: 100 ng/mL). Representative micrographs of C11 BODIPY immunofluorescence staining in HK-2 cells after MIF upregulation and downregulation.

  • MIF Protein, Human purchased from MedChemExpress. Usage Cited in: Commun Biol. 2025 Jul 28;8(1):1112. [Abstract]

    Western blot results of P-AMPK and GPX4 in HK-2 cells after 6 hours of hypoxia following the addition of rMIF (MIF Protein, Human: 100 ng/mL).

  • MIF Protein, Human purchased from MedChemExpress. Usage Cited in: Mol Med. 2024 Nov 29;30(1):237. [Abstract]

    rhMIF (MIF Protein, Human: 200 ng/mL) was incubated with PBMCs from RA patients for 6 hours, CD4+ T cells were sorted, and protein lysate was extracted for Western blot experiments.

  • MIF Protein, Human purchased from MedChemExpress. Usage Cited in: Mol Med. 2024 Nov 29;30(1):237. [Abstract]

    rhMIF (MIF Protein, Human: 200 ng/mL) was incubated with PBMCs from RA patients for 3 days, and the proportion of Th17 cells in the control and treatment groups was analyzed by flow cytometry.