MMP-9 Protein, Cynomolgus (HEK293, His)
The MMP-9 protein is a matrix metalloproteinase that is critical for local extracellular matrix proteolysis and leukocyte migration. It is suggested that it may be involved in bone osteoclastic resorption. MMP-9 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived MMP-9 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The MMP-9 protein is a matrix metalloproteinase that is critical for local extracellular matrix proteolysis and leukocyte migration. It is suggested that it may be involved in bone osteoclastic resorption. MMP-9 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived MMP-9 protein, expressed by HEK293 , with C-His labeled tag.
Background
MMP-9 Protein, a matrix metalloproteinase, plays a crucial role in local proteolysis of the extracellular matrix and facilitates leukocyte migration. It could be involved in bone osteoclastic resorption and cleaves KiSS1 at a specific Gly-|-Leu bond. Additionally, MMP-9 cleaves NINJ1 to generate the Secreted ninjurin-1 form and processes type IV and type V collagen into large C-terminal three-quarter fragments and shorter N-terminal one-quarter fragments. While degrading fibronectin, MMP-9 does not impact laminin or Pz-peptide, showcasing its selectivity in substrate cleavage.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-8*His
-
Accession
A0A2K5UU71 (A20-D706)
-
Gene ID102117693
-
Molecular Construction
-
N-term
-
MMP-9 (A20-D706)
Accession # A0A2K5UU71 -
8*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
MMP9; Matrix Metallopeptidase 9 (Gelatinase B, 92kDa Gelatinase, 92kDa Type IV Collagenase); Prev. CLG4B; Macrophage Gelatinase; Matrix Metalloproteinase 9 (Gelatinase B, 92kDa Gelatinase, 92kDa Type IV Collagenase); Type V Collagenase; Matrix Metalloprot
-
AA Sequence
APRQRQSTLVLFPGDLKTNLTDRQLAEDYLYRYGYTRVAEMHGDSKSLGPALLLLQKQLSLPQTGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIEDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTKFGNADGAACHFPFTFEGRSYSACTTDGRSDGVPWCSTTANYDTDRRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDQDKLYGFCPTRADSTVIGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDRDKKWGFCPDQGYSLFLVAAHEFGHALGLDHTSVPEALMYPMYRFTEEPPLHKDDVNGIQYLYGSRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVRPSDRPTAGPTGPPSAGPTGPPTAGPSTTTTVPLNPVDDACNVNIFDAITEIGNQLYLFKDGRYWRFSERRGSRLQGPFLIADTWPALPRKLDSAFEEPLSKKLFFFSGRQVWVYTGSSVLGPRRLDKLGLGADVAQVTGALRRGGKMLLFSGRRFWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYQEKAYFCQDRFYWRVSSQSGVNQVDQVGYVTYDILQCPED
-
Predicted Molecular Mass
77.4 kDa
-
Molecular Weight
Approximately 85-100 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
