MMP-9 Protein, Cynomolgus (HEK293, His)

The MMP-9 protein is a matrix metalloproteinase that is critical for local extracellular matrix proteolysis and leukocyte migration. It is suggested that it may be involved in bone osteoclastic resorption. MMP-9 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived MMP-9 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The MMP-9 protein is a matrix metalloproteinase that is critical for local extracellular matrix proteolysis and leukocyte migration. It is suggested that it may be involved in bone osteoclastic resorption. MMP-9 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived MMP-9 protein, expressed by HEK293 , with C-His labeled tag.

Background

MMP-9 Protein, a matrix metalloproteinase, plays a crucial role in local proteolysis of the extracellular matrix and facilitates leukocyte migration. It could be involved in bone osteoclastic resorption and cleaves KiSS1 at a specific Gly-|-Leu bond. Additionally, MMP-9 cleaves NINJ1 to generate the Secreted ninjurin-1 form and processes type IV and type V collagen into large C-terminal three-quarter fragments and shorter N-terminal one-quarter fragments. While degrading fibronectin, MMP-9 does not impact laminin or Pz-peptide, showcasing its selectivity in substrate cleavage.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • MMP-9 (A20-D706)
      Accession # A0A2K5UU71
    • 8*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    MMP9; Matrix Metallopeptidase 9 (Gelatinase B, 92kDa Gelatinase, 92kDa Type IV Collagenase); Prev. CLG4B; Macrophage Gelatinase; Matrix Metalloproteinase 9 (Gelatinase B, 92kDa Gelatinase, 92kDa Type IV Collagenase); Type V Collagenase; Matrix Metalloprot

  • AA Sequence

    APRQRQSTLVLFPGDLKTNLTDRQLAEDYLYRYGYTRVAEMHGDSKSLGPALLLLQKQLSLPQTGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIEDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTKFGNADGAACHFPFTFEGRSYSACTTDGRSDGVPWCSTTANYDTDRRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDQDKLYGFCPTRADSTVIGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDRDKKWGFCPDQGYSLFLVAAHEFGHALGLDHTSVPEALMYPMYRFTEEPPLHKDDVNGIQYLYGSRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVRPSDRPTAGPTGPPSAGPTGPPTAGPSTTTTVPLNPVDDACNVNIFDAITEIGNQLYLFKDGRYWRFSERRGSRLQGPFLIADTWPALPRKLDSAFEEPLSKKLFFFSGRQVWVYTGSSVLGPRRLDKLGLGADVAQVTGALRRGGKMLLFSGRRFWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYQEKAYFCQDRFYWRVSSQSGVNQVDQVGYVTYDILQCPED

  • Predicted Molecular Mass

    77.4 kDa

  • Molecular Weight

    Approximately 85-100 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00