MYL9 Protein, Human (P. pastoris, His)
MYL9 Protein, Human (P. pastoris, His) is the recombinant human-derived MYL9 protein, expressed by P. pastoris, with C-10*His tag.
- Species: Human
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MYL9 Protein, Human (P. pastoris, His) is the recombinant human-derived MYL9 protein, expressed by P. pastoris, with C-10*His tag.
Background
MYL9 is a myosin regulatory subunit that plays a crucial role in regulating contractile activity in both smooth muscle and nonmuscle cells via phosphorylation. It is involved in cytokinesis, receptor capping, and cell locomotion. In myoblasts, it may regulate PIEZO1-dependent cortical actomyosin assembly during myotube formation (By similarity).
Technical Parameters
-
Species Human
-
Source P. pastoris
-
Tag C-10*His
-
Accession
P24844 (S2-D172)
-
Gene ID13098
-
Molecular Construction
-
N-term
-
(S2-D172)
Accession # P24844 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
MYL9; Myosin Regulatory Light Chain MRLC1; Myosin Light Chain 9; Myosin, Light Chain 9, Regulatory; MYRL2; Myosin Regulatory Light Chain 1; MRLC1; Myosin Regulatory Light Chain 9; MLC2; 20 KDa Myosin Light Chain; LC20; Myosin RLC; Myosin Regulatory Light
-
AA Sequence
SSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
-
Predicted Molecular Mass
21.7 kDa
-
Molecular Weight
Approximately 18-22 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
