NECAP2 Protein, Human (His)
NECAP2 protein plays a pivotal role in endocytosis, interacting with adapter protein complexes AP-1 and AP-2, specifically with AP1G1 and AP2A1. Additionally, it connects with GAE domain proteins GGA1, GGA2, and GGA3, participating in a network of interactions that orchestrate endocytic events. NECAP2 emerges as a key regulator in cellular processes associated with membrane trafficking and vesicular transport. NECAP2 Protein, Human (His) is the recombinant human-derived NECAP2 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.
- Species: Human
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
NECAP2 protein plays a pivotal role in endocytosis, interacting with adapter protein complexes AP-1 and AP-2, specifically with AP1G1 and AP2A1. Additionally, it connects with GAE domain proteins GGA1, GGA2, and GGA3, participating in a network of interactions that orchestrate endocytic events. NECAP2 emerges as a key regulator in cellular processes associated with membrane trafficking and vesicular transport. NECAP2 Protein, Human (His) is the recombinant human-derived NECAP2 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.
NECAP2 protein assumes a pivotal role in the intricate process of endocytosis, where it interfaces with crucial components of adapter protein complexes AP-1 and AP-2, specifically interacting with AP1G1 and AP2A1. Furthermore, NECAP2 establishes connections with the GAE domain proteins GGA1, GGA2, and GGA3, revealing its involvement in a network of molecular interactions that contribute to the orchestration of endocytic events. Through these associations, NECAP2 emerges as a key player in regulating cellular processes associated with membrane trafficking and vesicular transport.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His;C-6*His
-
Accession
Q9NVZ3 (M1-F263)
-
Molecular Construction
-
N-term
-
6*His
-
NECAP2 (M1-F263)
Accession # Q9NVZ3 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
NECAP2; FLJ10420; NECAP Endocytosis Associated 2; NECAP Endocytosis-Associated Protein 2; Adaptin-Ear-Binding Coat-Associated Protein 2; NECAP-2; Adaptin Ear-Binding Coat-Associated Protein 2
-
AA Sequence
MEESGYESVLCVKPDVHVYRIPPRATNRGYRAAEWQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQCEFAKQAQNPDQGPKLDLGFKEGQTIKLNIANMKKKEGAAGNPRVRPASTGGLSLLPPPPGGKTSTLIPPPGEQLAVGGSLVQPAVAPSSGGAPVPWPQPNPATADIWGDFTKSTGSTSSQTQPGTGWVQF
-
Predicted Molecular Mass
31.5 kDa
-
Molecular Weight
Approximately 35 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
