Norrin Protein, Mouse

Customer Review

Based on 1 Customer Validation

Norrin protein is a key component of the canonical Wnt signaling pathway, activating the cascade by interacting with the FZD4 receptor and LRP5 coreceptor. Its role in retinal vascularization includes serving as a FZD4 ligand, stabilizing β-catenin (CTNNB1), and initiating LEF/TCF-mediated transcription. Norrin Protein, Mouse is the recombinant mouse-derived Norrin protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Norrin protein is a key component of the canonical Wnt signaling pathway, activating the cascade by interacting with the FZD4 receptor and LRP5 coreceptor. Its role in retinal vascularization includes serving as a FZD4 ligand, stabilizing β-catenin (CTNNB1), and initiating LEF/TCF-mediated transcription. Norrin Protein, Mouse is the recombinant mouse-derived Norrin protein, expressed by E. coli , with tag free.

Background

Norrin protein, a pivotal player in the canonical Wnt signaling pathway, activates this cascade through its interactions with the FZD4 receptor and the LRP5 coreceptor. Its central role in retinal vascularization is orchestrated by acting as a ligand for FZD4, thereby stabilizing beta-catenin (CTNNB1) and initiating LEF/TCF-mediated transcriptional programs. Collaborating with TSPAN12, Norrin demonstrates a unique ability to activate FZD4 independently of canonical Wnt signaling, suggesting the existence of an alternative, Wnt-independent pathway that also contributes to beta-catenin accumulation. Beyond its involvement in retinal vascularization, Norrin may participate in a broader regulatory network influencing neural cell differentiation and proliferation, as well as potential roles in neuroectodermal cell-cell interactions. Structurally, Norrin forms homodimers linked by disulfide bonds and is part of a larger complex containing TSPAN12, FZD4, LRP5/6, and itself, highlighting its multifaceted interactions within the cellular signaling landscape.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. When Mouse Norrin is coated at 0.5 μg/mL (100 μL/well) can bind Human Frizzled­4. The ED50 for this effect is 84.14 ng/mL.

Results
  • Experimental Validation Results for Norrin Protein, Mouse
    Measured by its binding ability in a functional ELISA. When Mouse Norrin is coated at 0.5 μg/mL (100 μL/well) can bind Human Frizzled­4. The ED50 for this effect is 84.14 ng/mL.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Norrin (K25-S131)
      Accession # P48744
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    Norrin; Ndp; Norrie disease protein homolog; Ndph

  • AA Sequence

    KTDSSFLMDSQRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECSS

  • Molecular Weight

    Approximately 12-14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

    • Experimental Validation Results for Norrin Protein, Mouse
      ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 4 mM HCl, pH 2.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00