Norrin Protein, Mouse
Based on 1 Customer Validation
Norrin protein is a key component of the canonical Wnt signaling pathway, activating the cascade by interacting with the FZD4 receptor and LRP5 coreceptor. Its role in retinal vascularization includes serving as a FZD4 ligand, stabilizing β-catenin (CTNNB1), and initiating LEF/TCF-mediated transcription. Norrin Protein, Mouse is the recombinant mouse-derived Norrin protein, expressed by E. coli , with tag free.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Norrin protein is a key component of the canonical Wnt signaling pathway, activating the cascade by interacting with the FZD4 receptor and LRP5 coreceptor. Its role in retinal vascularization includes serving as a FZD4 ligand, stabilizing β-catenin (CTNNB1), and initiating LEF/TCF-mediated transcription. Norrin Protein, Mouse is the recombinant mouse-derived Norrin protein, expressed by E. coli , with tag free.
Background
Norrin protein, a pivotal player in the canonical Wnt signaling pathway, activates this cascade through its interactions with the FZD4 receptor and the LRP5 coreceptor. Its central role in retinal vascularization is orchestrated by acting as a ligand for FZD4, thereby stabilizing beta-catenin (CTNNB1) and initiating LEF/TCF-mediated transcriptional programs. Collaborating with TSPAN12, Norrin demonstrates a unique ability to activate FZD4 independently of canonical Wnt signaling, suggesting the existence of an alternative, Wnt-independent pathway that also contributes to beta-catenin accumulation. Beyond its involvement in retinal vascularization, Norrin may participate in a broader regulatory network influencing neural cell differentiation and proliferation, as well as potential roles in neuroectodermal cell-cell interactions. Structurally, Norrin forms homodimers linked by disulfide bonds and is part of a larger complex containing TSPAN12, FZD4, LRP5/6, and itself, highlighting its multifaceted interactions within the cellular signaling landscape.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. When Mouse Norrin is coated at 0.5 μg/mL (100 μL/well) can bind Human Frizzled4. The ED50 for this effect is 84.14 ng/mL.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
P48744 (K25-S131)
-
Molecular Construction
-
N-term
-
Norrin (K25-S131)
Accession # P48744 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
NDP; Norrie Disease Protein; Prev. EVR2; NDP, Norrin Cystine Knot Growth Factor; Norrin; FEVR; X-Linked Exudative Vitreoretinopathy 2 Protein; ND; Norrie Disease (Pseudoglioma); Norrin Cystine Knot Growth Factor NDP; Exudative Vitreoretinopathy 2 (X-Linke
-
AA Sequence
KTDSSFLMDSQRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECSS
-
Molecular Weight
Approximately 12-14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 4 mM HCl, pH 2.5.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)