1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. OTUD3 Protein, Human

OTUD3 Protein, Human is the recombinant human-derived OTUD3, expressed by E. coli , with tag Free labeled tag. ,

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
50 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

OTUD3 Protein, Human is the recombinant human-derived OTUD3, expressed by E. coli , with tag Free labeled tag. ,

Background

OTUD3 is a deubiquitinating enzyme that hydrolyzes Lys-6- and Lys-11-linked polyubiquitin chains, as well as heterotypic (mixed and branched) and homotypic chains. It serves as a critical regulator of energy metabolism, with glucose and fatty acids triggering its nuclear translocation via CBP-dependent acetylation. In the nucleus, OTUD3 deubiquitinates and stabilizes the nuclear receptor PPARD, regulating the expression of genes involved in glucose and lipid metabolism and oxidative phosphorylation. Additionally, OTUD3 acts as a negative regulator of ribosome quality control (RQC) by mediating the deubiquitination of 40S ribosomal proteins RPS10/eS10 and RPS20/uS10, thereby counteracting ZNF598-mediated 40S ubiquitination.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q5T2D3 (E52-D209)

Gene ID

23252

Protein Length

Partial

Synonyms
KIAA0459
AA Sequence

EFVSFANQLQALGLKLREVPGDGNCLFRALGDQLEGHSRNHLKHRQETVDYMIKQREDFEPFVEDDIPFEKHVASLAKPGTFAGNDAIVAFARNHQLNVVIHQLNAPLWQIRGTEKSSVRELHIAYRYGEHYDSVRRINDNSEAPAHLQTDFQMLHQD

Predicted Molecular Mass
18.3 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES (pH 7.5), 200mM NaCl, 20% glycerol, 1mM DTT.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

OTUD3 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

OTUD3 Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
OTUD3 Protein, Human
Cat. No.:
HY-P703302
Quantity:
MCE Japan Authorized Agent: