OTUD3 Protein, Human
OTUD3 Protein, Human is the recombinant human-derived OTUD3, expressed by E. coli , with tag Free labeled tag. ,
- Species: Human
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
OTUD3 Protein, Human is the recombinant human-derived OTUD3, expressed by E. coli , with tag Free labeled tag. ,
OTUD3 is a deubiquitinating enzyme that hydrolyzes Lys-6- and Lys-11-linked polyubiquitin chains, as well as heterotypic (mixed and branched) and homotypic chains. It serves as a critical regulator of energy metabolism, with glucose and fatty acids triggering its nuclear translocation via CBP-dependent acetylation. In the nucleus, OTUD3 deubiquitinates and stabilizes the nuclear receptor PPARD, regulating the expression of genes involved in glucose and lipid metabolism and oxidative phosphorylation. Additionally, OTUD3 acts as a negative regulator of ribosome quality control (RQC) by mediating the deubiquitination of 40S ribosomal proteins RPS10/eS10 and RPS20/uS10, thereby counteracting ZNF598-mediated 40S ubiquitination.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q5T2D3 (E52-D209)
-
Gene ID23252
-
Protein Length
Partial
-
Synonyms
OTUD3; OTU Domain-Containing Protein 3; OTU Deubiquitinase 3; OTU Domain Containing 3; KIAA0459; OTUD3 Protein; DUBA4
-
AA Sequence
EFVSFANQLQALGLKLREVPGDGNCLFRALGDQLEGHSRNHLKHRQETVDYMIKQREDFEPFVEDDIPFEKHVASLAKPGTFAGNDAIVAFARNHQLNVVIHQLNAPLWQIRGTEKSSVRELHIAYRYGEHYDSVRRINDNSEAPAHLQTDFQMLHQD
-
Predicted Molecular Mass
18.3 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
