Copy Link Print Information

PMF1 Protein, Human

The PMF1 protein is part of the MIS12 complex and ensures the correct alignment, segregation and kinetochore formation of chromosomes in mitosis. It also acts as a co-transcriptional partner of NFE2L2, regulating polyamine-induced SSAT transcription. PMF1 Protein, Human is the recombinant human-derived PMF1 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • PMF1 Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The PMF1 protein is part of the MIS12 complex and ensures the correct alignment, segregation and kinetochore formation of chromosomes in mitosis. It also acts as a co-transcriptional partner of NFE2L2, regulating polyamine-induced SSAT transcription. PMF1 Protein, Human is the recombinant human-derived PMF1 protein, expressed by E. coli , with tag free.

Background

PMF1 protein is an integral part of the MIS12 complex, crucial for maintaining normal chromosome alignment and segregation, as well as kinetochore formation during mitosis. Additionally, PMF1 may function as a cotranscription partner of NFE2L2, participating in the regulation of polyamine-induced transcription of SSAT. As a component of the MIS12 complex, PMF1 collaborates with MIS12, DSN1, and NSL1. It exhibits interaction with COPS7A and, notably, binds to the leucine-zipper domain of NFE2L2 via its coiled-coil domain. This interaction with NFE2L2 is essential for the transcriptional regulation of SSAT, emphasizing PMF1's role in coordinating cellular processes related to chromosome dynamics and transcriptional regulation.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    Q6P1K2 (M1-E205)

  • Gene ID
    100527963
  • Molecular Construction
    • N-term
    • PMF1 (M1-E205)
      Accession # Q6P1K2
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    PMF1; Polyamine-modulated factor 1; PMF-1

  • AA Sequence

    MAEASSANLGSGCEEKRHEGSSSESVPPGTTISRVKLLDTMVDTFLQKLVAAGSYQRFTDCYKCFYQLQPAMTQQIYDKFIAQLQTSIREEISDIKEEGNLEAVLNALDKIVEEGKVRKEPAWRPSGIPEKDLHSVMAPYFLQQRDTLRRHVQKQEAENQQLADAVLAGRRQVEELQLQVQAQQQAWQALHREQRELVAVLREPE

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • PMF1 Protein, Human Product Image
    1/16
  • PMF1 Protein, Human Product Image