PMVK Protein, Human (His)
PMVK proteins play a key role in cellular metabolism by catalyzing the reversible ATP-dependent phosphorylation of mevalonate 5-phosphate, leading to the production of mevalonate diphosphate and ADP. This enzymatic activity represents a key step in the mevalonate-mediated biosynthesis of isopentenyl diphosphate, a precursor for the synthesis of various polyisoprene metabolites. PMVK Protein, Human (His) is the recombinant human-derived PMVK protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
PMVK proteins play a key role in cellular metabolism by catalyzing the reversible ATP-dependent phosphorylation of mevalonate 5-phosphate, leading to the production of mevalonate diphosphate and ADP. This enzymatic activity represents a key step in the mevalonate-mediated biosynthesis of isopentenyl diphosphate, a precursor for the synthesis of various polyisoprene metabolites. PMVK Protein, Human (His) is the recombinant human-derived PMVK protein, expressed by E. coli , with N-6*His labeled tag.
The PMVK (Phosphomevalonate kinase) protein is an enzyme that catalyzes a pivotal step in the mevalonate pathway, which is crucial for the biosynthesis of isopentenyl diphosphate and various polyisoprenoid metabolites. Specifically, PMVK facilitates the reversible ATP-dependent phosphorylation of mevalonate 5-phosphate, generating mevalonate diphosphate and ADP. This enzymatic activity is essential for the production of isoprenoids, which serve as precursors for essential cellular components such as sterols, dolichols, and ubiquinones. The mevalonate pathway, in which PMVK participates, plays a central role in diverse biological processes, including cholesterol synthesis and regulation of cell membrane integrity. Understanding the functions of PMVK provides insights into the regulation of isoprenoid metabolism and its implications for various cellular functions.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q15126 (M1-L192)
-
Molecular Construction
-
N-term
-
6*His
-
PMVK (M1-L192)
Accession # Q15126 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
PMVK; PMKASE; Phosphomevalonate Kinase; POROK1; HUMPMKI; PMKase; PMKA; HPMK; PMK; PMKI; Testis Tissue Sperm-Binding Protein Li 95mP
-
AA Sequence
MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRSRL
-
Predicted Molecular Mass
24.2 kDa
-
Molecular Weight
Approximately 26 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
