1. Recombinant Proteins
  2. Others
  3. Polyphosphate glucokinase Protein, Thermobifida fusca

Polyphosphate glucokinase Protein, Thermobifida fusca

Cat. No.: HY-P703524
Handling Instructions Technical Support

Polyphosphate glucokinase Protein, Thermobifida fusca is the recombinant Polyphosphate glucokinase protein, expressed by E. coli, with tag free tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

Polyphosphate glucokinase Protein, Thermobifida fusca is the recombinant Polyphosphate glucokinase protein, expressed by E. coli, with tag free tag.

Species

Others

Source

E. coli

Tag

Tag Free

Accession

Q47NX5 (M1-A262)

Gene ID

/

Protein Length

Full Length

Synonyms
Thermobifida fusca (strain YX); Kinase; Transferase
AA Sequence

MASRGRVGLGIDIGGSGIKGAPVDLDRGTFVVDRVKIATPQPATPEAVAAVVAEIVTAFADDVPQDAPLGVTFPAVIQHGVARSAANVDRSWIGTNVEELLSAVTGRRVLVVNDADAAAMAEHRYGAASGVDGVVLLTTLGTGIGTAVLVDGVLLPNTEFGHLEIDGYDAETRASASAKERENLSYKEWAEERLQRYYSVIEDLLWPDLIVVGGGVSRKADKFLPHLRLRAPIVPAKLRNTAGIVGAAVLAAERLGGDRVSA

Predicted Molecular Mass
28.3 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

Polyphosphate glucokinase Protein, Thermobifida fusca Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Polyphosphate glucokinase Protein, Thermobifida fusca

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Polyphosphate glucokinase Protein, Thermobifida fusca
Cat. No.:
HY-P703524
수량:
MCE Japan Authorized Agent: