PRTN3 Protein, Human (HEK293, His, solution)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

PRTN3 is a serine protease that broadly targets elastin, fibronectin, laminin, vitronectin, and collagen types I, III, and IV in vitro, playing a crucial role in extracellular matrix degradation. It modulates endothelial cell barrier function by cleaving and activating the receptor F2RL1/PAR-2 and enhances vascular integrity during neutrophil transendothelial migration. PRTN3 Protein, Human (HEK293, His, solution) is the recombinant human-derived PRTN3 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PRTN3 is a serine protease that broadly targets elastin, fibronectin, laminin, vitronectin, and collagen types I, III, and IV in vitro, playing a crucial role in extracellular matrix degradation. It modulates endothelial cell barrier function by cleaving and activating the receptor F2RL1/PAR-2 and enhances vascular integrity during neutrophil transendothelial migration. PRTN3 Protein, Human (HEK293, His, solution) is the recombinant human-derived PRTN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

PRTN3, a serine protease, exhibits a broad substrate specificity, targeting elastin, fibronectin, laminin, vitronectin, and collagen types I, III, and IV in vitro. Its enzymatic activity plays a crucial role in the degradation of these extracellular matrix components. Additionally, PRTN3 takes part in the modulation of endothelial cell barrier function by cleaving and activating the receptor F2RL1/PAR-2, thereby enhancing vascular integrity during neutrophil transendothelial migration. Notably, its potential involvement in neutrophil transendothelial migration is suggested, particularly when associated with CD177, emphasizing its significance in immune-related processes.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • PRTN3 (A26-R249)
      Accession # P24158
    • 6*His
    • C-term
  • Protein Length

    Full Length of Myeloblastin Chain

  • Synonyms

    PRTN3; Neutrophil Proteinase 4; Proteinase 3; Leukocyte Proteinase 3; AGP7; Wegener Autoantigen; PR-3; C-ANCA Antigen; P29; NP-4; Myeloblastin; MBN; C-ANCA; PR3; ACPA; Azurophil Granule Protein 7; MBT; CANCA; Wegener Granulomatosis Autoantigen; NP4; Serin

  • AA Sequence

    AEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRR

  • Predicted Molecular Mass

    25.6 kDa

  • Molecular Weight

    Approximately 34 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 10 mM Tris-HCl, 150 mM NaCl, 10% Glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00