Copy Link Print Information

PTH1R Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

PTH1R Protein, Human (HEK 293, His) is a recombinant PTH1R protein with a His-Flag. PTH1R plays an important role in skeletal development and homeostasis.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for PTH1R Protein, Human (HEK293, His)
  • Experimental Validation Results for PTH1R Protein, Human (HEK293, His)
  • PTH1R Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

PTH1R Protein, Human (HEK 293, His) is a recombinant PTH1R protein with a His-Flag. PTH1R plays an important role in skeletal development and homeostasis[1].

Background

PTH1R belongs to the secretin class of G protein coupled receptors (GPCRs). PTH1R is involved in bone development and bone cell differentiation, and normally activated by parathyroid hormone (PTH) and parathyroid hormone-related peptide (PTHrP).
PTH1R that is mainly expressed in cells of the osteoblastic lineage。PTH1R regulates bone metabolism, signaling mainly through Gs and Gq/11 G-proteins.
PTH1R is a critical regulator of skeletal development and homeostasis[1][2].

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human PTH1R at 2 μg/mL (100 μL/well) can Biotinylated Human PTHrP. The ED50 for this effect is 0.05-0.15 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE. The protein migrates as a 25-35 kDa band under reducing SDS-PAGE due to varying glycosylation.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When Recombinant Human PTH1R is used at 2 μg/mL, the concentration of biotinylated human PTHrP that produces 50% of the optimal binding response is found to 84.57 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q03431 (Y23-M189)

  • Gene ID
    5745  [NCBI]
  • Molecular Construction
    • N-term
    • PTH1R (Y23-M189)
      Accession # Q03431
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    PTH1R; PTH/PTHr Receptor; Prev. PTHR1; Parathyroid Hormone/Parathyroid Hormone-Related Protein Receptor; Prev. PTHR; Seven Transmembrane Helix Receptor; Parathyroid Hormone/Parathyroid Hormone-Related Peptide Receptor; EKNS; PTH/PTHrP Type I Receptor; PFE

  • AA Sequence

    YALVDADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLGM

  • Molecular Weight

    Approximately 22-40 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Bryce W Pickard, et al. Type 1 parathyroid hormone receptor (PTH1R) nuclear trafficking: association of PTH1R with importin alpha1 and beta. Endocrinology. 2006 Jul;147(7):3326-32. [Content Brief]

[2]. Xuekun Fu, et al. Al. Kindlin-2 regulates skeletal homeostasis by modulating PTH1R in mice. Signal Transduct Target Ther. 2020 Dec 26;5(1):297. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE. The protein migrates as a 25-35 kDa band under reducing SDS-PAGE due to varying glycosylation.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. When Recombinant Human PTH1R is used at 2 μg/mL, the concentration of biotinylated human PTHrP that produces 50% of the optimal binding response is found to 84.57 ng/mL.

  • PTH1R Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for PTH1R Protein, Human (HEK293, His)
  • Experimental Validation Results for PTH1R Protein, Human (HEK293, His)
  • PTH1R Protein, Human (HEK293, His) Product Image