1. Recombinant Proteins
  2. Others
  3. PTHrP Protein, Human (His)

The PTHrP protein is a key neuroendocrine peptide that regulates multiple cellular processes, including growth, development, migration, differentiation, and survival. It plays an integral role in epithelial calcium transport and key developmental events such as endochondral bone development, mammary gland, and tooth formation. PTHrP Protein, Human (His) is the recombinant human-derived PTHrP protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PTHrP protein is a key neuroendocrine peptide that regulates multiple cellular processes, including growth, development, migration, differentiation, and survival. It plays an integral role in epithelial calcium transport and key developmental events such as endochondral bone development, mammary gland, and tooth formation. PTHrP Protein, Human (His) is the recombinant human-derived PTHrP protein, expressed by E. coli , with N-6*His labeled tag.

Background

Parathyroid hormone-related protein (PTHrP) emerges as a pivotal neuroendocrine peptide that orchestrates diverse cellular processes, encompassing growth, development, migration, differentiation, and survival, along with its integral role in epithelial calcium ion transport. Its regulatory influence extends to critical developmental events, such as endochondral bone development and the intricate interactions shaping mammary gland and tooth formation. PTHrP's indispensable contribution to skeletal homeostasis underscores its significance in maintaining bone integrity. Within the mammary context, PTHrP plays a multifaceted role, driving mesenchymal differentiation, promoting bud outgrowth, and modulating responsiveness to bone morphogenetic proteins (BMPs), thus intricately shaping mammary tissue architecture. Additionally, PTHrP influences colon cancer cell behavior, enhancing migration and invasion through integrin alpha-6/beta-1-dependent mechanisms. Notably, osteostatin, a derivative of PTHrP, exhibits potent inhibitory effects on osteoclastic bone resorption, emphasizing its role in bone metabolism regulation.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Human PTH1R at 2μg/mL (100μl/well) on the plate can bind Biotinylated Human PTHrP. The ED50 for this effect is 0.0979 μg/mL.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P12272 (A37-R175)

Gene ID

5744

Molecular Construction
N-term
6*His
PTHrP (A37-R175)
Accession # P12272
C-term
Protein Length

Partial

Synonyms
Parathyroid hormone related protein; Parathyroid hormone-like protein; Parathyroid like protein; PLP; PTH related protein; PTH-rP; PTHLH; PTHR; PTHR_HUMAN; PTHrP; PTHrP
AA Sequence

AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSR

Molecular Weight

19.7 kDa

Purity
  • ≥ 90%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PTHrP Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PTHrP Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PTHrP Protein, Human (His)
Cat. No.:
HY-P702562
Quantity:
MCE Japan Authorized Agent: