PTHrP Protein, Human (His)

Customer Review

Based on 1 Customer Validation

The PTHrP protein is a key neuroendocrine peptide that regulates multiple cellular processes, including growth, development, migration, differentiation, and survival. It plays an integral role in epithelial calcium transport and key developmental events such as endochondral bone development, mammary gland, and tooth formation. PTHrP Protein, Human (His) is the recombinant human-derived PTHrP protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The PTHrP protein is a key neuroendocrine peptide that regulates multiple cellular processes, including growth, development, migration, differentiation, and survival. It plays an integral role in epithelial calcium transport and key developmental events such as endochondral bone development, mammary gland, and tooth formation. PTHrP Protein, Human (His) is the recombinant human-derived PTHrP protein, expressed by E. coli , with N-6*His labeled tag.

Background

Parathyroid hormone-related protein (PTHrP) emerges as a pivotal neuroendocrine peptide that orchestrates diverse cellular processes, encompassing growth, development, migration, differentiation, and survival, along with its integral role in epithelial calcium ion transport. Its regulatory influence extends to critical developmental events, such as endochondral bone development and the intricate interactions shaping mammary gland and tooth formation. PTHrP's indispensable contribution to skeletal homeostasis underscores its significance in maintaining bone integrity. Within the mammary context, PTHrP plays a multifaceted role, driving mesenchymal differentiation, promoting bud outgrowth, and modulating responsiveness to bone morphogenetic proteins (BMPs), thus intricately shaping mammary tissue architecture. Additionally, PTHrP influences colon cancer cell behavior, enhancing migration and invasion through integrin alpha-6/beta-1-dependent mechanisms. Notably, osteostatin, a derivative of PTHrP, exhibits potent inhibitory effects on osteoclastic bone resorption, emphasizing its role in bone metabolism regulation.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human PTH1R at 2μg/mL (100μl/well) on the plate can bind Biotinylated Human PTHrP. The ED50 for this effect is 0.0979 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • PTHrP (A37-R175)
      Accession # P12272
    • C-term
  • Protein Length

    Full Length of Parathyroid hormone-related protein Chain

  • Synonyms

    PTHLH; Osteostatin; Parathyroid Hormone Like Hormone; PTHrP; PTHRP; Parathyroid Hormone-Related Protein Preproprotein; PLP; Parathyroid Hormone-Like Related Protein; Parathyroid Hormone-Related Protein; Parathyroid Hormone-Like Protein; PTH-RP; PTH-Relate

  • AA Sequence

    AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSR

  • Molecular Weight

    Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00