RAB5C Protein, Human (HEK293, His)
Based on 1 Customer Validation
The IL5 protein is a cytokine that plays a key role in regulating immune responses, particularly in promoting the production and activation of eosinophils. It is involved in regulating allergic and inflammatory processes. RAB5C Protein, Human (HEK293, His) is the recombinant human-derived RAB5C, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The IL5 protein is a cytokine that plays a key role in regulating immune responses, particularly in promoting the production and activation of eosinophils. It is involved in regulating allergic and inflammatory processes. RAB5C Protein, Human (HEK293, His) is the recombinant human-derived RAB5C, expressed by HEK293 , with C-His labeled tag.
Background
RAB5C, a member of the Rab protein family, is a small GTPase of the Ras superfamily that is believed to play a role in ensuring the accuracy of vesicle docking and/or fusion with their appropriate acceptor compartment. It is ubiquitously expressed in various tissues, including the kidney (RPKM 55.2), bone marrow (RPKM 47.2), and 25 other tissues.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
NP_958842 (M1-N216)
-
Gene ID5878
-
Molecular Construction
-
N-term
-
RAB5C (M1-N216)
Accession # NP_958842 -
His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
RAB5C; Ras-Related Protein Rab-5C; Prev. RABL; RAB5L; RAB5CL; RAB, Member Of RAS Oncogene Family-Like; RAB5C, Member Of RAS Oncogene Family; RAB5C, Member RAS Oncogene Family; L1880
-
AA Sequence
MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN
-
Predicted Molecular Mass
23.5 kDa
-
Molecular Weight
Approximately 25 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)