Copy Link Print Information

NRG1-beta 1 Protein, Human

9 Cited Publications
Customer Review

Based on 9 publication(s) in Google Scholar

NRG1-beta 1 Protein, a specific ligand for ERBB3, belongs to a family of structurally related polypeptide growth factors. NRG1-beta 1 Protein can regulate cell proliferation, differentiation, apoptosis and migration. NRG1-beta 1 Protein plays an important role in tumors and neurological diseases, and also has certain neuroprotective activity. NRG-1 Protein, Human is a recombinant NRG1-beta 1 protein expressed by E. coli without tags.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for NRG1-beta 1 Protein, Human
  • Experimental Validation Results for NRG1-beta 1 Protein, Human
  • Experimental Validation Results for NRG1-beta 1 Protein, Human
  • Experimental Validation Results for NRG1-beta 1 Protein, Human
  • Experimental Validation Results for NRG1-beta 1 Protein, Human
  • Experimental Validation Results for NRG1-beta 1 Protein, Human
  • NRG1-beta 1 Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

NRG1-beta 1 Protein, a specific ligand for ERBB3, belongs to a family of structurally related polypeptide growth factors. NRG1-beta 1 Protein can regulate cell proliferation, differentiation, apoptosis and migration. NRG1-beta 1 Protein plays an important role in tumors and neurological diseases, and also has certain neuroprotective activity. NRG-1 Protein, Human is a recombinant NRG1-beta 1 protein expressed by E. coli without tags[1][2][3][4][5].

Background

NRG1-beta 1 has an epidermal growth factor-like domain. As a ligand for ErbB3, NRG1-beta 1 can induce the formation of ErbB2-ErbB3 (HER2-HER3) heterodimers, thereby activating downstream signaling pathways such as PI3K/AKT and MAPK. NRG1-beta 1 promotes tumor cell survival, migration and invasion. NRG1-beta 1 also participates in processes such as neuronal migration, proliferation, differentiation and synaptic establishment[1][2][3][4][5].

In Vitro

NRG1-beta 1 Protein (Human; 40 ng/mL; 12 h) can inhibit DEPTOR protein levels in MCF7 and MDA-MB-361 cells[4].

In Vivo

NRG1-beta 1 Protein (Human; 0.05-1 μg/kg; intravenous injection; 7 days) has a protective effect in a mouse model of photothrombotic ischemia, reducing cerebral infarction, restoring forelimb function, and promoting the proliferation and differentiation of neurons and oligodendrocytes[5].

Verified Bioactivity

Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED50 this effect is ≤ 2.158 ng/mL, corresponding to a specific activity is ≥ 4.6339×105 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    Q02297-6 (S177-E241)

  • Gene ID
    3084  [NCBI]
  • Molecular Construction
    • N-term
    • NRG1-beta 1 (S177-E241)
      Accession # Q02297-6
    • C-term
  • Protein Length

    Partial

  • Synonyms

    NRG1; NRG1 Class VII Isoform Alpha 2a; Prev. HGL; NRG1 Class VII Isoform Beta 2a; Prev. NRG1-IT2; Neuregulin 1 Isoform HRG-Gamma; NDF; Neuregulin 1 Isoform HRG-Beta3; GGF; Neuregulin 1 Isoform HRG-Beta2; Pro-Neuregulin-1, Membrane-Bound Isoform; Neureguli

  • AA Sequence

    SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE

  • Predicted Molecular Mass

    7.5 kDa

  • Molecular Weight

    Approximately 8-10 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, pH 8.0.
3.Lyophilized from a 0.22 μm filtered solution of PBS, 8% trehalose, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Asrani K, et al. The HER2- and heregulin β1 (HRG)-inducible TNFR superfamily member Fn14 promotes HRG-driven breast cancer cell migration, invasion, and MMP9 expression. Mol Cancer Res. 2013 Apr;11(4):393-404. [Content Brief]

[2]. Curley MD, et al. Seribantumab, an Anti-ERBB3 Antibody, Delays the Onset of Resistance and Restores Sensitivity to Letrozole in an Estrogen Receptor-Positive Breast Cancer Model. Mol Cancer Ther. 2015 Nov;14(11):2642-52. [Content Brief]

[3]. Yao YL, et al. Proliferation of colorectal cancer is promoted by two signaling transduction expression patterns: ErbB2/ErbB3/AKT and MET/ErbB3/MAPK. PLoS One. 2013 Oct 30;8(10):e78086. [Content Brief]

[4]. Bi Y, et al. Nuclear ErbB2 represses DEPTOR transcription to inhibit autophagy in breast cancer cells. Cell Death Dis. 2021 Apr 14;12(4):397. [Content Brief]

[5]. Cui MY, et al. Neuregulin-1/PI3K signaling effects on oligodendrocyte proliferation, remyelination and behaviors deficit in a male mouse model of ischemic stroke. Exp Neurol. 2023 Apr;362:114323. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a serum-free cell proliferation assay using MCF‑7 human breast cancer cells. The ED50 this effect is ≤ 2.158 ng/mL, corresponding to a specific activity is ≥ 4.6339×105 units/mg.

  • 1/16

    NRG1-beta 1 Protein, Human purchased from MedChemExpress. Usage Cited in: Exp Neurol. 2023 Apr:362:114323. [Abstract]

    Customer Validation
     Effect of NRG1 (0.05, 0.5 and 1 μg/kg) treatment on the brain infarct size by CV staining at 1-day post-ischemia.

  • 1/16

    NRG1-beta 1 Protein, Human purchased from MedChemExpress. Usage Cited in: Exp Neurol. 2023 Apr:362:114323. [Abstract]

    Customer Validation
     NRG1 (NRG1-beta 1 Protein, Human: 0.5 μg/kg). Dual immunofluorescence staining for SMI-32 and MBP was performed. Relative optical density (ROD) is expressed as a percentage of SMI-32 and MBP immunofluorescence in the peri-infarct region.

  • 1/16

    NRG1-beta 1 Protein, Human purchased from MedChemExpress. Usage Cited in: Exp Neurol. 2023 Apr:362:114323. [Abstract]

    Customer Validation
     NRG1 (NRG1-beta 1 Protein, Human: 0.5 μg/kg). Western blot analysis was performed on SMI-32 and MBP in the periinfarct region of the sham-operated group, vector group, NRG1 treatment group, and NRG1 + LY treatment group.

  • 1/16

    NRG1-beta 1 Protein, Human purchased from MedChemExpress. Usage Cited in: Cell Death Dis. 2021 Apr 14;12(4):397. [Abstract]

    Customer Validation
     Cells were transfected with indicated plasmids, and treated with or without 40 ng/ml of HRGβ-1 (NRG1-beta 1 Protein, Human) for 12 h, and then, subjected to IB with indicated Abs.

  • NRG1-beta 1 Protein, Human Product Image
    1/16
  • Experimental Validation Results for NRG1-beta 1 Protein, Human
  • Experimental Validation Results for NRG1-beta 1 Protein, Human
  • Experimental Validation Results for NRG1-beta 1 Protein, Human
  • Experimental Validation Results for NRG1-beta 1 Protein, Human
  • Experimental Validation Results for NRG1-beta 1 Protein, Human
  • Experimental Validation Results for NRG1-beta 1 Protein, Human
  • NRG1-beta 1 Protein, Human Product Image

  • NRG1-beta 1 Protein, Human purchased from MedChemExpress. Usage Cited in: Exp Neurol. 2023 Apr:362:114323. [Abstract]

    Effect of NRG1 (0.05, 0.5 and 1 μg/kg) treatment on the brain infarct size by CV staining at 1-day post-ischemia.

  • NRG1-beta 1 Protein, Human purchased from MedChemExpress. Usage Cited in: Exp Neurol. 2023 Apr:362:114323. [Abstract]

    NRG1 (NRG1-beta 1 Protein, Human: 0.5 μg/kg). Dual immunofluorescence staining for SMI-32 and MBP was performed. Relative optical density (ROD) is expressed as a percentage of SMI-32 and MBP immunofluorescence in the peri-infarct region.

  • NRG1-beta 1 Protein, Human purchased from MedChemExpress. Usage Cited in: Exp Neurol. 2023 Apr:362:114323. [Abstract]

    NRG1 (NRG1-beta 1 Protein, Human: 0.5 μg/kg). Western blot analysis was performed on SMI-32 and MBP in the periinfarct region of the sham-operated group, vector group, NRG1 treatment group, and NRG1 + LY treatment group.

  • NRG1-beta 1 Protein, Human purchased from MedChemExpress. Usage Cited in: Cell Death Dis. 2021 Apr 14;12(4):397. [Abstract]

    Cells were transfected with indicated plasmids, and treated with or without 40 ng/ml of HRGβ-1 (NRG1-beta 1 Protein, Human) for 12 h, and then, subjected to IB with indicated Abs.