RhoC Protein, Human/Mouse/Rat (His)
- Species: Rat; Mouse; Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Help & FAQs
Technical Parameters
-
Species Rat; Mouse; Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P08134/Q62159/NP_001099931.1 (M1-C190)
-
Gene ID389;11853;95342
-
Molecular Construction
-
N-term
-
RhoA (M1-C190)
Accession # P08134 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
Rho-related GTP-binding protein RhoC; Rho cDNA clone 9 (h9); RHOC; ARH9; ARHC
-
AA Sequence
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGC
-
Predicted Molecular Mass
28.6 kDa
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
