1. Recombinant Proteins
  2. Receptor Proteins
  3. RORa Protein, Human (sf9, His)

The RORa protein is a nuclear receptor that is critical for a variety of physiological processes including development, immunity, circadian rhythms, and metabolic pathways. RORa operates as a monomer, binding DNA to RORE and exhibiting intrinsic transcriptional activity. RORa Protein, Human (sf9, His) is the recombinant human-derived RORa protein, expressed by sf9 insect cells , with N-8*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The RORa protein is a nuclear receptor that is critical for a variety of physiological processes including development, immunity, circadian rhythms, and metabolic pathways. RORa operates as a monomer, binding DNA to RORE and exhibiting intrinsic transcriptional activity. RORa Protein, Human (sf9, His) is the recombinant human-derived RORa protein, expressed by sf9 insect cells , with N-8*His labeled tag.

Background

RORa Protein, a nuclear receptor, functions as a key regulator in diverse physiological processes, including embryonic development, cellular differentiation, immunity, circadian rhythm, and metabolism of lipids, steroids, xenobiotics, and glucose. Operating as a monomer, RORa binds DNA to ROR response elements (RORE) and exhibits intrinsic transcriptional activity. Natural ligands like oxysterols act as agonists or inverse agonists, modulating its transcriptional activity. RORa recruits distinct cofactor combinations to target gene regulatory regions, modulating their expression depending on tissue, time, and promoter contexts. Its regulatory influence extends to genes involved in photoreceptor and skeletal muscle development, cerebellum development, granule cell proliferation, calcium-mediated signal transduction, and circadian expression of clock genes. In the liver, RORa, along with RORC, acts as a positive or negative modulator of lipid, steroid, and xenobiotic metabolism genes. It also plays a role in hepatic glucose metabolism and adipocyte differentiation regulation. Moreover, RORa is implicated in CD4(+) T-helper cell lineage specification into T(H)17 cells, inhibits NF-kappa-B signaling, and interacts with HIF1A in hypoxia signaling. The multifaceted interactions of RORa with various cofactors and regulatory elements underscore its versatile role in orchestrating complex biological processes.

Species

Human

Source

Sf9 insect cells

Tag

N-8*His

Accession

P35398 (A271-G523)

Gene ID

6095

Molecular Construction
N-term
8*His
RORa (A271-G523)
Accession # P35398
C-term
Protein Length

Partial

Synonyms
RORA; Nuclear receptor ROR-alpha; Nuclear receptor RZR-alpha; Nuclear receptor subfamily 1 group F member 1; RAR-related orphan receptor A; Retinoid-related orphan receptor-alpha
AA Sequence

AELEHLAQNISKSHLETCQYLREELQQITWQTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEIALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRALCGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG

Molecular Weight

31.8 kDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 200 mM NaCl, 20% glycerol 1 mM DTT.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

RORa Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

RORa Protein, Human (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RORa Protein, Human (sf9, His)
Cat. No.:
HY-P701401
Quantity:
MCE Japan Authorized Agent: