RORa Protein, Human (sf9, His)
Based on 1 Customer Validation
The RORa protein is a nuclear receptor that is critical for a variety of physiological processes including development, immunity, circadian rhythms, and metabolic pathways. RORa operates as a monomer, binding DNA to RORE and exhibiting intrinsic transcriptional activity. RORa Protein, Human (sf9, His) is the recombinant human-derived RORa protein, expressed by sf9 insect cells , with N-8*His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The RORa protein is a nuclear receptor that is critical for a variety of physiological processes including development, immunity, circadian rhythms, and metabolic pathways. RORa operates as a monomer, binding DNA to RORE and exhibiting intrinsic transcriptional activity. RORa Protein, Human (sf9, His) is the recombinant human-derived RORa protein, expressed by sf9 insect cells , with N-8*His labeled tag.
Background
RORa Protein, a nuclear receptor, functions as a key regulator in diverse physiological processes, including embryonic development, cellular differentiation, immunity, circadian rhythm, and metabolism of lipids, steroids, xenobiotics, and glucose. Operating as a monomer, RORa binds DNA to ROR response elements (RORE) and exhibits intrinsic transcriptional activity. Natural ligands like oxysterols act as agonists or inverse agonists, modulating its transcriptional activity. RORa recruits distinct cofactor combinations to target gene regulatory regions, modulating their expression depending on tissue, time, and promoter contexts. Its regulatory influence extends to genes involved in photoreceptor and skeletal muscle development, cerebellum development, granule cell proliferation, calcium-mediated signal transduction, and circadian expression of clock genes. In the liver, RORa, along with RORC, acts as a positive or negative modulator of lipid, steroid, and xenobiotic metabolism genes. It also plays a role in hepatic glucose metabolism and adipocyte differentiation regulation. Moreover, RORa is implicated in CD4(+) T-helper cell lineage specification into T(H)17 cells, inhibits NF-kappa-B signaling, and interacts with HIF1A in hypoxia signaling. The multifaceted interactions of RORa with various cofactors and regulatory elements underscore its versatile role in orchestrating complex biological processes.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-8*His
-
Accession
P35398 (A271-G523)
-
Gene ID6095
-
Molecular Construction
-
N-term
-
8*His
-
RORa (A271-G523)
Accession # P35398 -
C-term
-
-
Protein Length
Partial
-
Synonyms
RORA; RAR-Related Orphan Nuclear Receptor Alpha; RAR Related Orphan Receptor A; RAR-Related Orphan Receptor A; NR1F1; Nuclear Receptor RZR-Alpha; RZRA; Retinoic Acid Receptor-Related Orphan Receptor Alpha; Nuclear Receptor Subfamily 1 Group F Member 1; RA
-
AA Sequence
AELEHLAQNISKSHLETCQYLREELQQITWQTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEIALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRALCGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG
-
Predicted Molecular Mass
31.8 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 200 mM NaCl, 20% glycerol 1 mM DTT.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)