RXRB Protein, Human (His)
RXRB protein is a receptor for retinoic acid and forms a heterodimer, especially RAR/RXR, which regulates gene expression through the retinoic acid response element (RARE). RXRB exhibits homodimerization and forms heterodimers with other retinoic acid receptor family members. RXRB Protein, Human (His) is the recombinant human-derived RXRB protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
RXRB protein is a receptor for retinoic acid and forms a heterodimer, especially RAR/RXR, which regulates gene expression through the retinoic acid response element (RARE). RXRB exhibits homodimerization and forms heterodimers with other retinoic acid receptor family members. RXRB Protein, Human (His) is the recombinant human-derived RXRB protein, expressed by E. coli , with N-6*His labeled tag.
Background
The RXRB Protein functions as the receptor for retinoic acid, forming heterodimers with retinoic acid receptors in response to ligands such as all-trans or 9-cis retinoic acid. These heterodimers, particularly RAR/RXR, play a pivotal role in the regulation of gene expression across diverse biological processes by binding to retinoic acid response elements (RARE). Notably, RXRB exhibits homodimerization in vitro, as reported in studies, and forms heterodimers with other members of the retinoic acid receptor family. Its DNA binding preference is established as a RAR/RXR heterodimer, as documented in research. Furthermore, RXRB interacts with NR1H3 and AKAP13, expanding its associations and suggesting a nuanced involvement in cellular signaling pathways.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P28702 (G294-A528)
-
Gene ID6257
-
Molecular Construction
-
N-term
-
6*His
-
RXRB (G294-A528)
Accession # P28702 -
C-term
-
-
Protein Length
Full Length of NR LBD Domain
-
Synonyms
RXRB; Retinoid X Receptor, Beta; Retinoid X Receptor Beta; MHC Class I Promoter Binding Protein; NR2B2; Retinoid X Receptor Beta Isoform 2; Nuclear Receptor Subfamily 2 Group B Member 2; Retinoid X Receptor Beta Isoform 4; H-2RIIBP; Retinoid X Receptor Be
-
AA Sequence
GAPEEMPVDRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKYPEQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEA
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)