S100A13 Protein, Mouse (His, solution)
Based on 1 Customer Validation
S100A13 Protein, acting as a homodimer, facilitates the export of signal peptide-lacking proteins through an alternative pathway, binding two calcium ions and one copper ion per subunit.It is crucial for the copper-dependent stress-induced export of IL1A and FGF1, with the calcium-free form binding to phosphatidylserine-containing lipid vesicles.S100A13 is part of a copper-dependent multiprotein complex, interacting with FGF1, SYT1, and IL1A.S100A13 Protein, Mouse (His, solution) is the recombinant mouse-derived S100A13 protein, expressed by E.coli , with N-His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
S100A13 Protein, acting as a homodimer, facilitates the export of signal peptide-lacking proteins through an alternative pathway, binding two calcium ions and one copper ion per subunit.It is crucial for the copper-dependent stress-induced export of IL1A and FGF1, with the calcium-free form binding to phosphatidylserine-containing lipid vesicles.S100A13 is part of a copper-dependent multiprotein complex, interacting with FGF1, SYT1, and IL1A.S100A13 Protein, Mouse (His, solution) is the recombinant mouse-derived S100A13 protein, expressed by E.coli , with N-His labeled tag.
Background
The S100A13 protein plays a crucial role in the export of proteins that lack a signal peptide and are secreted through an alternative pathway. It has the ability to bind two calcium ions per subunit and one copper ion, with the binding of the latter not interfering with calcium binding. S100A13 is essential for the copper-dependent stress-induced export of IL1A and FGF1. Interestingly, the calcium-free form of the protein can bind to lipid vesicles containing phosphatidylserine but not those containing phosphatidylcholine. S100A13 functions as a homodimer and is part of a copper-dependent multiprotein complex alongside FGF1 and SYT1. It also interacts with FGF1, SYT1, and IL1A.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-His
-
Accession
P97352 (M1-K98)
-
Molecular Construction
-
N-term
-
His
-
S100A13 (M1-K98)
Accession # P97352 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
S100A13; S100 Calcium-Binding Protein A13; S100 Calcium Binding Protein A13; Protein S100-A13
-
AA Sequence
MAAETLTELEAAIETVVSTFFTFAGREGRKGSLNINEFKELATQQLPHLLKDVGSLDEKMKTLDVNQDSELRFSEYWRLIGELAKEVRKEKALGIRKK
-
Predicted Molecular Mass
13.2 kDa
-
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, 10% glycerol, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (233 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
