SPINK4 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
The SPINK4 protein acts as a serine-type endopeptidase inhibitor, regulating peptidase activity.It is located in the extracellular region, suggesting that it has inhibitory functions outside the cell.SPINK4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived SPINK4 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The SPINK4 protein acts as a serine-type endopeptidase inhibitor, regulating peptidase activity.It is located in the extracellular region, suggesting that it has inhibitory functions outside the cell.SPINK4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived SPINK4 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
SPINK4 protein is anticipated to play a crucial role as a serine-type endopeptidase inhibitor, suggesting its involvement in the intricate regulation of peptidase activity. With a predicted location in the extracellular region, this protein may exert its inhibitory function in the extracellular milieu. Its expression in diverse tissues, including brain ventricular layer, ganglia, liver lobe, and olfactory epithelium, underscores its potential involvement in various physiological processes. The biased expression in large intestine and colon adult tissues emphasizes its potential role in local regulatory mechanisms within the digestive system. The orthologous relationship with human SPINK4, identified as a serine peptidase inhibitor of the Kazal type 4, further supports the evolutionary conservation of its functional significance across species.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
NP_035593.2 (G27-C86)
-
Molecular Construction
-
N-term
-
SPINK4 (G27-C86)
Accession # NP_035593.2 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
SPINK4; MGC133107; Serine Peptidase Inhibitor Kazal Type 4; Serine Peptidase Inhibitor, Kazal Type 4; PEC-60; Serine Protease Inhibitor, Kazal Type 4; Serine Protease Inhibitor Kazal-Type 4; Gastrointestinal Peptide; Epididymis Luminal Protein 136; HEL136
-
AA Sequence
GSLVFPRMPFCEHMAELPNCPQTPNLICGTDGLTYENECHLCLTRMKTMKDIQIMKDGQC
-
Predicted Molecular Mass
7.6 kDa
-
Molecular Weight
Approximately 11 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)