SPINK4 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

The SPINK4 protein acts as a serine-type endopeptidase inhibitor, regulating peptidase activity.It is located in the extracellular region, suggesting that it has inhibitory functions outside the cell.SPINK4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived SPINK4 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The SPINK4 protein acts as a serine-type endopeptidase inhibitor, regulating peptidase activity.It is located in the extracellular region, suggesting that it has inhibitory functions outside the cell.SPINK4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived SPINK4 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

SPINK4 protein is anticipated to play a crucial role as a serine-type endopeptidase inhibitor, suggesting its involvement in the intricate regulation of peptidase activity. With a predicted location in the extracellular region, this protein may exert its inhibitory function in the extracellular milieu. Its expression in diverse tissues, including brain ventricular layer, ganglia, liver lobe, and olfactory epithelium, underscores its potential involvement in various physiological processes. The biased expression in large intestine and colon adult tissues emphasizes its potential role in local regulatory mechanisms within the digestive system. The orthologous relationship with human SPINK4, identified as a serine peptidase inhibitor of the Kazal type 4, further supports the evolutionary conservation of its functional significance across species.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • SPINK4 (G27-C86)
      Accession # NP_035593.2
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    SPINK4; MGC133107; Serine Peptidase Inhibitor Kazal Type 4; Serine Peptidase Inhibitor, Kazal Type 4; PEC-60; Serine Protease Inhibitor, Kazal Type 4; Serine Protease Inhibitor Kazal-Type 4; Gastrointestinal Peptide; Epididymis Luminal Protein 136; HEL136

  • AA Sequence

    GSLVFPRMPFCEHMAELPNCPQTPNLICGTDGLTYENECHLCLTRMKTMKDIQIMKDGQC

  • Predicted Molecular Mass

    7.6 kDa

  • Molecular Weight

    Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00