ST3GAL3 Protein, Human (His-SUMO)
Based on 1 Customer Validation
ST3GAL3 protein plays a central role in cellular processes by catalyzing the formation of NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc-, NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- and NeuAc-α-2,3-Gal-beta-1,3-GalNAc- sequences are present in the terminal carbohydrate groups of glycoproteins and glycolipids. ST3GAL3 Protein, Human (His-SUMO) is the recombinant human-derived ST3GAL3 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
ST3GAL3 protein plays a central role in cellular processes by catalyzing the formation of NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc-, NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- and NeuAc-α-2,3-Gal-beta-1,3-GalNAc- sequences are present in the terminal carbohydrate groups of glycoproteins and glycolipids. ST3GAL3 Protein, Human (His-SUMO) is the recombinant human-derived ST3GAL3 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
Background
ST3GAL3, or sialyltransferase 3, is an enzyme that catalyzes the formation of terminal carbohydrate sequences on glycoproteins and glycolipids. Specifically, it is responsible for adding sialic acid to the Gal-beta-1,3-GlcNAc, Gal-beta-1,3-GlcNAc, and Gal-beta-1,3-GalNAc structures, resulting in the formation of NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc, NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc, and NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc sequences. These sialylation events play a crucial role in modulating the structure and function of glycoproteins and glycolipids, impacting various cellular processes. ST3GAL3 exhibits varying degrees of activity towards different substrates, with the highest activity observed towards Gal-beta-1,3-GlcNAc and the lowest towards Gal-beta-1,3-GalNAc. It has to succinctly outline ST3GAL3's role in catalyzing the addition of sialic acid to specific carbohydrate structures, highlighting its contribution to the diversity of terminal glycan sequences in biological molecules.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His;N-SUMO
-
Accession
Q11203 (K29-I375)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
ST3GAL3 (K29-I375)
Accession # Q11203 -
C-term
-
-
Protein Length
Lumenal Domain
-
Synonyms
ST3GAL3; Alpha 2,3-ST 3; Prev. SIAT6; Sialyltransferase 6 (N-Acetyllacosaminide Alpha 2,3-Sialyltransferase); Prev. MRT12; Mental Retardation, Non-Syndromic, Autosomal Recessive, 12; ST3Gal III; Gal Beta-1,3(4)GlcNAc Alpha-2,3 Sialyltransferase; CMP-N-Ace
-
AA Sequence
KLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDDYDIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI
-
Predicted Molecular Mass
54.9 kDa
-
Molecular Weight
Approximately 55 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)