Copy Link Print Information

ST3GAL3 Protein, Human (His-SUMO)

Customer Review

Based on 1 Customer Validation

ST3GAL3 protein plays a central role in cellular processes by catalyzing the formation of NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc-, NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- and NeuAc-α-2,3-Gal-beta-1,3-GalNAc- sequences are present in the terminal carbohydrate groups of glycoproteins and glycolipids. ST3GAL3 Protein, Human (His-SUMO) is the recombinant human-derived ST3GAL3 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • ST3GAL3 Protein, Human (His-SUMO) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

ST3GAL3 protein plays a central role in cellular processes by catalyzing the formation of NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc-, NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- and NeuAc-α-2,3-Gal-beta-1,3-GalNAc- sequences are present in the terminal carbohydrate groups of glycoproteins and glycolipids. ST3GAL3 Protein, Human (His-SUMO) is the recombinant human-derived ST3GAL3 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Background

ST3GAL3, or sialyltransferase 3, is an enzyme that catalyzes the formation of terminal carbohydrate sequences on glycoproteins and glycolipids. Specifically, it is responsible for adding sialic acid to the Gal-beta-1,3-GlcNAc, Gal-beta-1,3-GlcNAc, and Gal-beta-1,3-GalNAc structures, resulting in the formation of NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc, NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc, and NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc sequences. These sialylation events play a crucial role in modulating the structure and function of glycoproteins and glycolipids, impacting various cellular processes. ST3GAL3 exhibits varying degrees of activity towards different substrates, with the highest activity observed towards Gal-beta-1,3-GlcNAc and the lowest towards Gal-beta-1,3-GalNAc. It has to succinctly outline ST3GAL3's role in catalyzing the addition of sialic acid to specific carbohydrate structures, highlighting its contribution to the diversity of terminal glycan sequences in biological molecules.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His;N-SUMO
  • Accession

    Q11203 (K29-I375)

  • Gene ID
    6487  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His-SUMO
    • ST3GAL3 (K29-I375)
      Accession # Q11203
    • C-term
  • Protein Length

    Lumenal Domain

  • Synonyms

    ST3GAL3; Alpha 2,3-ST 3; Prev. SIAT6; Sialyltransferase 6 (N-Acetyllacosaminide Alpha 2,3-Sialyltransferase); Prev. MRT12; Mental Retardation, Non-Syndromic, Autosomal Recessive, 12; ST3Gal III; Gal Beta-1,3(4)GlcNAc Alpha-2,3 Sialyltransferase; CMP-N-Ace

  • AA Sequence

    KLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDDYDIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI

  • Predicted Molecular Mass

    54.9 kDa

  • Molecular Weight

    Approximately 55 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • ST3GAL3 Protein, Human (His-SUMO) Product Image
    1/16
  • ST3GAL3 Protein, Human (His-SUMO) Product Image