TAF15 Protein, Human (His, Strep)
Based on 1 Customer Validation
TAF15 Protein, Human (His, Strep) is the recombinant human-derived TAF15, expressed by E. coli , with Strep, His labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
TAF15 Protein, Human (His, Strep) is the recombinant human-derived TAF15, expressed by E. coli , with Strep, His labeled tag. ,
Background
TAF15 is an RNA and ssDNA-binding protein that may play specific roles during transcription initiation at distinct promoters. It binds to ssRNA containing the consensus sequence 5'-AGGUAA-3'. Additionally, TAF15 can enter the preinitiation complex together with RNA polymerase II (Pol II). by similar: Other studies suggest this protein might be involved in early stages of transcriptional regulation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Strep;His
-
Accession
Q92804 (S148-R406)
-
Gene ID8148
-
Protein Length
Partial
-
Synonyms
TAF15; HTAFII68; Prev. TAF2N; TATA Box-Binding Protein-Associated Factor 2N (RNA-Binding Protein 56); RBP56; 68 KDa TATA-Binding Protein-Associated Factor; Npl3; TBP-Associated Factor 15; TATA Box Binding Protein (TBP)-Associated Factor, RNA Polymerase II
-
AA Sequence
SYHSQRENYSHHTQDDRRDVSRYGEDNRGYGGSQGGGRGRGGYDKDGRGPMTGSSGGDRGGFKNFGGHRDYGPRTDADSESDNSDNNTIFVQGLGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLYTDKDTGKPKGEATVSFDDPPSAKAAIDWFDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGYRGRGGFQGRGGDPKSGDWVCPNPSCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGGERGYR
-
Predicted Molecular Mass
31.2 kDa
-
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM HEPES (pH 7.5), 200mM NaCl, 20% glycerol, 1mM DTT.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)