1. Recombinant Proteins
  2. Others
  3. TXNL4A Protein, Human (His)

The TXNL4A protein plays a key role in pre-mRNA splicing and is an important component of U5 snRNP, U4/U6-U5 tri-snRNP complex, and precatalytic spliceosome (spliceosome B complex). It contributes to spliceosome assembly and is an integral part of the complex process of spliceosome function. TXNL4A Protein, Human (His) is the recombinant human-derived TXNL4A protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TXNL4A protein plays a key role in pre-mRNA splicing and is an important component of U5 snRNP, U4/U6-U5 tri-snRNP complex, and precatalytic spliceosome (spliceosome B complex). It contributes to spliceosome assembly and is an integral part of the complex process of spliceosome function. TXNL4A Protein, Human (His) is the recombinant human-derived TXNL4A protein, expressed by E. coli , with N-His labeled tag.

Background

TXNL4A protein is integral to pre-mRNA splicing, serving as a critical component in the U5 snRNP and U4/U6-U5 tri-snRNP complexes, both essential for spliceosome assembly and the formation of the precatalytic spliceosome (spliceosome B complex). Within the U4/U6-U5 tri-snRNP complex, comprising U4, U6, and U5 snRNAs, TXNL4A collaborates with various proteins, including PRPF3, PRPF4, PRPF6, PRPF8, and others, to create a foundation for the precatalytic spliceosome. Its direct interaction with CD2BP2 and association with proteins like HNRPF, HNRPH2, NEDD9, and PQBP1 highlight TXNL4A's multifaceted involvement in the intricate machinery orchestrating pre-mRNA splicing. Additionally, TXNL4A interacts with ERBB4, showcasing its potential connections to broader cellular processes.

Species

Human

Source

E. coli

Tag

N-His

Accession

P83876 (M1-Y142)

Gene ID
Molecular Construction
N-term
His
TXNL4A (M1-Y142)
Accession # P83876
C-term
Protein Length

Full Length

Synonyms
Thioredoxin-like protein 4A; DIM1 protein homolog; DIM1; TXNL4
AA Sequence

MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY

Predicted Molecular Mass
16.8 kDa
Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TXNL4A Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TXNL4A Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TXNL4A Protein, Human (His)
Cat. No.:
HY-P77269
Quantity:
MCE Japan Authorized Agent: