TXNL4A Protein, Human (His)

Customer Review

Based on 1 Customer Validation

The TXNL4A protein plays a key role in pre-mRNA splicing and is an important component of U5 snRNP, U4/U6-U5 tri-snRNP complex, and precatalytic spliceosome (spliceosome B complex). It contributes to spliceosome assembly and is an integral part of the complex process of spliceosome function. TXNL4A Protein, Human (His) is the recombinant human-derived TXNL4A protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The TXNL4A protein plays a key role in pre-mRNA splicing and is an important component of U5 snRNP, U4/U6-U5 tri-snRNP complex, and precatalytic spliceosome (spliceosome B complex). It contributes to spliceosome assembly and is an integral part of the complex process of spliceosome function. TXNL4A Protein, Human (His) is the recombinant human-derived TXNL4A protein, expressed by E. coli , with N-His labeled tag.

Background

TXNL4A protein is integral to pre-mRNA splicing, serving as a critical component in the U5 snRNP and U4/U6-U5 tri-snRNP complexes, both essential for spliceosome assembly and the formation of the precatalytic spliceosome (spliceosome B complex). Within the U4/U6-U5 tri-snRNP complex, comprising U4, U6, and U5 snRNAs, TXNL4A collaborates with various proteins, including PRPF3, PRPF4, PRPF6, PRPF8, and others, to create a foundation for the precatalytic spliceosome. Its direct interaction with CD2BP2 and association with proteins like HNRPF, HNRPH2, NEDD9, and PQBP1 highlight TXNL4A's multifaceted involvement in the intricate machinery orchestrating pre-mRNA splicing. Additionally, TXNL4A interacts with ERBB4, showcasing its potential connections to broader cellular processes.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • TXNL4A (M1-Y142)
      Accession # P83876
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    TXNL4A; Thioredoxin-Like Protein 4A; Thioredoxin Like 4A; DIM1 Protein Homolog; TXNL4; Thioredoxin-Like 4; DIM1; HsT161; U5-15kD; Thioredoxin-Like 4A, Isoform CRA_a; SNRNP15; Similar To S. Pombe Dim1+; DIB1; Thioredoxin-Like 4A; Spliceosomal U5 SnRNP-Spec

  • AA Sequence

    MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY

  • Predicted Molecular Mass

    16.8 kDa

  • Molecular Weight

    Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00