VEGF165 Protein, Human (Biotinylated, HEK293, Avi)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

VEGF165 is a member of the PDGF/VEGF family encoding a heparin-binding homodimer that is crucial in inducing vascular endothelial cell proliferation and migration during angiogenesis. The VEGF gene is critical for blood vessel development, and its disruption leads to abnormal blood vessel formation in mouse embryos. VEGF165 Protein, Human (Biotinylated, HEK293, Avi) is the recombinant human-derived VEGF165 protein, expressed by HEK293 , with N-Avi labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

VEGF165 is a member of the PDGF/VEGF family encoding a heparin-binding homodimer that is crucial in inducing vascular endothelial cell proliferation and migration during angiogenesis. The VEGF gene is critical for blood vessel development, and its disruption leads to abnormal blood vessel formation in mouse embryos. VEGF165 Protein, Human (Biotinylated, HEK293, Avi) is the recombinant human-derived VEGF165 protein, expressed by HEK293 , with N-Avi labeled tag.

Background

VEGF165, a member of the PDGF/VEGF growth factor family, encodes a heparin-binding protein that forms a disulfide-linked homodimer. This growth factor plays a pivotal role in inducing proliferation and migration of vascular endothelial cells, crucial for both physiological and pathological angiogenesis. Disruption of the VEGF gene in mice resulted in aberrant embryonic blood vessel formation, underscoring its importance in vascular development. Elevated expression of VEGF is observed in various tumors, correlating with tumor stage and progression. Additionally, increased levels of VEGF are associated with conditions such as POEMS syndrome, microvascular complications of diabetes 1 (MVCD1), and atherosclerosis. Alternative splicing gives rise to different isoforms, including a C-terminally extended isoform with antiangiogenic properties. During infection with severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), VEGF levels are heightened, contributing to inflammation by recruiting inflammatory cells and increasing the levels of angiopoietin II (Ang II), thereby establishing a feedback loop with Ang II to perpetuate the release of inflammatory cytokines. The broad expression of VEGF in tissues like the thyroid, prostate, and 21 other tissues emphasizes its widespread involvement in diverse physiological processes.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Anti-VEGFA antibody at 5 μg/mL can bind Biotinylated Human VEGF165. The EC50 is 2.291-7.120 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-Avi
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Avi
    • VEGF165 (A27-R191)
      Accession # P15692-4/NP_001165097
    • C-term
  • Protein Length

    Full Length of Mature VEGF165

  • Conjugation

    Biotin

  • Synonyms

    VEGFA; Vascular Endothelial Growth Factor A; VEGF; VPF; Vascular Permeability Factor; Vascular Endothelial Growth Factor A, Long Form; VEGF-A; L-VEGF; Vascular Endothelial Growth Factor A121; Vascular Endothelial Growth Factor A165; Vascular Endothelial G

  • AA Sequence

    APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

  • Predicted Molecular Mass

    22.7 kDa

  • Molecular Weight

    Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00