1. Recombinant Proteins
  2. Cytokines and Growth Factors Biotinylated Proteins
  3. VEGF & VEGFR
  4. VEGF
  5. VEGF-A
  6. VEGF165 Protein, Human (Biotinylated, HEK293, Avi)

VEGF165 Protein, Human (Biotinylated, HEK293, Avi)

Cat. No.: HY-P78813
Handling Instructions Technical Support

VEGF165 is a member of the PDGF/VEGF family encoding a heparin-binding homodimer that is crucial in inducing vascular endothelial cell proliferation and migration during angiogenesis. The VEGF gene is critical for blood vessel development, and its disruption leads to abnormal blood vessel formation in mouse embryos. VEGF165 Protein, Human (Biotinylated, HEK293, Avi) is the recombinant human-derived VEGF165 protein, expressed by HEK293 , with N-Avi labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE VEGF165 Protein, Human (Biotinylated, HEK293, Avi)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

VEGF165 is a member of the PDGF/VEGF family encoding a heparin-binding homodimer that is crucial in inducing vascular endothelial cell proliferation and migration during angiogenesis. The VEGF gene is critical for blood vessel development, and its disruption leads to abnormal blood vessel formation in mouse embryos. VEGF165 Protein, Human (Biotinylated, HEK293, Avi) is the recombinant human-derived VEGF165 protein, expressed by HEK293 , with N-Avi labeled tag.

Background

VEGF165, a member of the PDGF/VEGF growth factor family, encodes a heparin-binding protein that forms a disulfide-linked homodimer. This growth factor plays a pivotal role in inducing proliferation and migration of vascular endothelial cells, crucial for both physiological and pathological angiogenesis. Disruption of the VEGF gene in mice resulted in aberrant embryonic blood vessel formation, underscoring its importance in vascular development. Elevated expression of VEGF is observed in various tumors, correlating with tumor stage and progression. Additionally, increased levels of VEGF are associated with conditions such as POEMS syndrome, microvascular complications of diabetes 1 (MVCD1), and atherosclerosis. Alternative splicing gives rise to different isoforms, including a C-terminally extended isoform with antiangiogenic properties. During infection with severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), VEGF levels are heightened, contributing to inflammation by recruiting inflammatory cells and increasing the levels of angiopoietin II (Ang II), thereby establishing a feedback loop with Ang II to perpetuate the release of inflammatory cytokines. The broad expression of VEGF in tissues like the thyroid, prostate, and 21 other tissues emphasizes its widespread involvement in diverse physiological processes.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Anti-VEGFA antibody at 5 μg/mL can bind Biotinylated Human VEGF165. The EC50 is 2.291-7.120 ng/mL.

Species

Human

Source

HEK293

Tag

N-Avi

Accession

P15692-4/NP_001165097 (A27-R191)

Gene ID
Molecular Construction
N-term
Avi
VEGF165 (A27-R191)
Accession # P15692-4/NP_001165097
C-term
Protein Length

Partial

Conjugation

Biotin

Conjugate Method

The single lysine residue in Avitag is biotinylated through an enzymatic reaction.

Synonyms
RP1-261G23.1; MGC70609; MVCD1; VEGFA; VPF
AA Sequence

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Predicted Molecular Mass
22.7 kDa
Molecular Weight

Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

VEGF165 Protein, Human (Biotinylated, HEK293, Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

VEGF165 Protein, Human (Biotinylated, HEK293, Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VEGF165 Protein, Human (Biotinylated, HEK293, Avi)
Cat. No.:
HY-P78813
Quantity:
MCE Japan Authorized Agent: