Aminopeptidase P2 Protein, Mouse (HEK293, His)
Aminopeptidase P2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Aminopeptidase P2 protein, expressed by HEK293, with C-His tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Aminopeptidase P2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Aminopeptidase P2 protein, expressed by HEK293, with C-His tag.
Background
Aminopeptidase P2 is a membrane-bound metalloprotease that catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides, such as Arg-Pro-Pro. It may play a role in the metabolism of the vasodilator bradykinin.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-8*His
-
Accession
B1AVD1 (P23-A650)
-
Gene ID170745
-
Protein Length
Full Length of Mature Protein
-
Synonyms
XPNPEP2; X-Prolyl Aminopeptidase 2; Xaa-Pro Aminopeptidase 2; Membrane-Bound Aminopeptidase P; X-Prolyl Aminopeptidase (Aminopeptidase P) 2; Membrane-Bound; Aminoacylproline Aminopeptidase; X-Pro Aminopeptidase 2; Membrane-Bound APP; Membrane-Bound AmP;
-
AA Sequence
PEPKYLGREDVRNCSTSPERLPVTAVNTTMRLAALRQQMETWNLSAYIIPDTDAHMSEYIGKPDKRREWISGFTGSAGTAVVTMGKAAVWTDSRYWTQAERQMDCNWELHKEVSISSIVAWILAEVPDGQNVGFDPFLFSVDSWKNYDQGFQDSSRHLLSVTTNLVDVAWGSERPPVPSQPIYALPKEFTGSTWQEKVSAVRSYMEHHAKTPTGVLLSALDETAWLFNLRSSDIPYNPFFYSYALLTNSSIRLFVNKSRFSLETLQYLNTNCTLPMCVQLEDYSQVRDSVKAYASGDVKILIGVSYTTYGVYEVIPKEKLVTDTYSPVMLIKAVKNSKEQALLKSSHVRDAVAVIQYLVWLEKNVPKGTVDEFSGAEYIDELRRNENFSSGPSFETISASGLNAALAHYSPTKELHRKLSSDEMYLVDSGGQYWDGTTDITRTVHWGTPTAFQKEAYTRVLMGNIDLSRLVFPAATSGRVIEAFARRALWEVGLNYGHGTGHGIGNFLCVHEWPVGFQYNNIAMAKGMFTSIEPGYYHDGEFGIRLEDVALVVEAKTKYPGDYLTFELVSFVPYDRNLIDVRLLSPEQLQYLNRYYQTIRENVGPELQRRQLLEEFAWLEQHTEPLSA
-
Predicted Molecular Mass
72.2 kDa
-
Molecular Weight
Approximately 75-105 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
