TIP 39, Tuberoinfundibular Neuropeptide
Based on 1 publication(s) in Google Scholar
TIP 39, Tuberoinfundibular Neuropeptide is an endogenous PTH2 receptor agonist and antihypertensive agent. TIP 39, Tuberoinfundibular Neuropeptide selectively activates the PTH2 receptor with no activity on the PTH1 receptor, stimulates cAMP production, activates adenylate cyclase, and elevates intracellular calcium levels via mobilization from intracellular stores. TIP 39, Tuberoinfundibular Neuropeptide is highly conserved in humans, mice, and rats. TIP 39, Tuberoinfundibular Neuropeptide is applicable to research related to nociception and inflammation-induced pain.
For research use only. We do not sell to patients.
- Purity: 99.83%
- CAS No.: 277302-47-3
- Formula: C202H325N61O54S
- Molecular Weight:4504.20
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Purity & Documentation
- References
-
Help & FAQs
-
HY-P0059
Teriparatide
-
HY-B0166
L-Ascorbic acid
-
HY-P0264
Exendin(9-39) amide
-
HY-P1024
GLP-2(1-33)(human)
-
HY-P1465
Human secretin
-
HY-B0468
Isoprenaline hydrochloride
-
HY-P1295
Urocortin, human
-
HY-109538
Secretin (swine)
-
HY-P1495
Small Cardioactive Peptide B (SCPB)
-
HY-P71060
PTH Protein, Human (HEK293, His)
-
HY-P0089A
Human growth hormone-releasing factor TFA
-
HY-100396
SQ22536
Publications Citing Use of MedChemExpress (MCE) TIP 39, Tuberoinfundibular Neuropeptide
More
Biological Activity
|
PTH2R |
TIP 39, Tuberoinfundibular Neuropeptide stimulates arginine vasopressin release from in vitro rat hypothalamic explants[1].
TIP 39, Tuberoinfundibular Neuropeptide (log[ligand] M -13 to -6; 10 min) potently activate adenylyl cyclase to increase cAMP levels in HEK293 cells stably expressing human PTH2R, each with an EC50 of 0.2 nM[2].
TIP 39, Tuberoinfundibular Neuropeptide (log[ligand] M -11 to -5, 1 μM; acute addition) potently elevate intracellular calcium levels via mobilization from intracellular stores in HEK293 cells stably expressing human PTH2R, with EC50 values of 25 nM and 16 nM, respectively[2].
TIP 39, Tuberoinfundibular Neuropeptide (tested concentrations; 10 min) with N-terminal truncation reduces potency but retains full adenylyl cyclase activation efficacy in HEK293 cells stably expressing human PTH2R; C-terminal truncation to 30 or more residues retains full efficacy with reduced potency, while truncation to 29 residues eliminates activity[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
TIP 39, Tuberoinfundibular Neuropeptide (100 pmol/rat; i.c.v.; single injection) produces a significant reduction in mean arterial pressure in conscious rats, with measurable effects at 20 minutes post-injection[1].
TIP 39, Tuberoinfundibular Neuropeptide (100 pmol/rat; i.c.v.; single injection) reduces dehydration-induced plasma AVP levels by 47.4% in conscious rats, with maximum effect at 5 minutes post-injection[1].
TIP 39, Tuberoinfundibular Neuropeptide (1-500 pmol/rat; i.c.v.; single injection) significantly suppresses dehydration-induced plasma AVP elevation in conscious rats, with a 32.7% reduction observed at 100 pmol/rat[1].
TIP 39, Tuberoinfundibular Neuropeptide (100 pmol/rat; i.c.v.; single injection) suppresses both hyperosmolality-induced and hypovolemia-induced plasma AVP elevation in conscious rats by 43.5% and 33.8%, respectively[1].
TIP 39, Tuberoinfundibular Neuropeptide (100 pmol/rat; i.c.v.; single injection) has an inhibitory effect on dehydration-induced plasma AVP release in conscious rats that is mediated by intrinsic opioid systems, as it is reversed by naloxone pretreatment[1].
TIP 39, Tuberoinfundibular Neuropeptide (10-100 pmol, 1.0 nmol; i.c.v.; single dose) partially reverses carrageenan-induced tactile allodynia at 10 and 100 pmol, reduces pain-related affective behavior at 1.0 nmol, and does not alter acute nociceptive responses in hot-plate or formalin tests in adult male Sprague-Dawley rats[3].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Sprague Dawley (male, 250-300 g)[1]
-
Dosage:100 pmol/rat
-
Administration:i.c.v.; single injection
-
Result:Decreased plasma arginine vasopressin (AVP) levels to 0.70 pg/mL at 5 minutes post-injection.
Showed no significant decrease in plasma AVP at 15 minutes post-injection.
Left plasma Na+ and total protein levels unchanged.\nGradually decreased mean arterial pressure to 85.1 mm Hg at 20 minutes post-injection.
-
Animal Model:Sprague Dawley (male, 250-300 g, 48-hour water deprivation)[1]
-
Dosage:100 pmol/rat
-
Administration:i.c.v.; single injection
-
Result:Suppressed dehydration-induced plasma AVP elevation to 4.32 pg/mL at 5 minutes post-injection.
-
Animal Model:Sprague Dawley (male, 250-300 g, 48-hour water deprivation)[1]
-
Dosage:1 pmol/rat; 10 pmol/rat; 100 pmol/rat; 500 pmol/rat
-
Administration:i.c.v.; single injection
-
Result:Significantly suppressed dehydration-induced plasma AVP elevation at doses of 10, 100, and 500 pmol/rat.
Reduced plasma AVP levels to 4.64 pg/mL a 32.7% reduction, at 100 pmol/rat.
Left plasma Na+ and total protein levels unchanged.
-
Animal Model:Sprague Dawley (male, 250-300 g, hyperosmolality/hypovolemia induction)[1]
-
Dosage:100 pmol/rat
-
Administration:i.c.v.; single injection
-
Result:Suppressed hyperosmolality-induced plasma AVP elevation to 2.65 pg/mL.
Suppressed hypovolemia-induced plasma AVP elevation to 4.10 pg/mL.
Left plasma Na+ and total protein levels unchanged.
-
Animal Model:Sprague Dawley (male, 250-300 g, 48-hour water deprivation, naloxone pretreatment)[1]
-
Dosage:100 pmol/rat
-
Administration:i.c.v.; single injection
-
Result:Had its inhibitory effect on dehydration-induced plasma AVP elevation significantly reversed by pretreatment with naloxone, a nonselective opioid receptor antagonist.
-
Animal Model:Sprague-Dawley (adult male, 180-250 g; intraplantar lambda carrageenan-induced inflammatory pain)[3]
-
Dosage:10 pmol; 100 pmol; 1.0 nmol
-
Administration:i.c.v.; single dose
-
Result:Did not significantly change paw withdrawal latency in hot-plate assay.
Did not significantly reduce pain scores in either phase 1 (0-10 minutes) or phase 2 (20-50 minutes) of formalin test.
Partially reversed carrageenan-induced tactile hypersensitivity 2 minutes post-administration at 10 pmol and 100 pmol; this effect was absent by ~40 minutes post-administration.
Did not significantly affect tactile withdrawal threshold at 1.0 nmol.
Significantly decreased the escape/avoidance response (time spent in the light chamber side) to stimulation of the inflamed paw at 1.0 nmol; an apparent effect was observed with the 100 pmol dose, while the 10 pmol dose showed no significant difference from vehicle.
Chemical Information
-
CAS No. 277302-47-3
-
Appearance Solid
-
Molecular Weight 4504.20
-
Formula C202H325N61O54S
-
Color White to off-white
-
Sequence
Ser-Leu-Ala-Leu-Ala-Asp-Asp-Ala-Ala-Phe-Arg-Glu-Arg-Ala-Arg-Leu-Leu-Ala-Ala-Leu-Glu-Arg-Arg-His-Trp-Leu-Asn-Ser-Tyr-Met-His-Lys-Leu-Leu-Val-Leu-Asp-Ala-Pro
-
Sequence Shortening
SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications (1)
-
Journal Impact Factor
-
Most Recent
Solvent & Solubility
H2O : 50 mg/mL (11.10 mM; Need ultrasonic)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (297 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Sugimura Y, et al. Centrally administered tuberoinfundibular peptide of 39 residues inhibits arginine vasopressin release in conscious rats. Endocrinology. 2003;144(7):2791-2796. [Content Brief]
[2]. Della Penna K, et al. Tuberoinfundibular peptide of 39 residues (TIP39): molecular structure and activity for parathyroid hormone 2 receptor. Neuropharmacology. 2003;44(1):141-153. [Content Brief]
[3]. LaBuda CJ, et al. Tuberoinfundibular peptide of 39 residues decreases pain-related affective behavior. Neuroreport. 2004;15(11):1779-1782. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O | 1 mM | 0.2220 mL | 1.1101 mL | 2.2201 mL | 5.5504 mL |
| 5 mM | 0.0444 mL | 0.2220 mL | 0.4440 mL | 1.1101 mL | |
| 10 mM | 0.0222 mL | 0.1110 mL | 0.2220 mL | 0.5550 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
TIP 39, Tuberoinfundibular Neuropeptide Related Classifications
HY-P1852 Related Classifications
Powered by Bioz