Linvixdutide
Linvixdutide is a glucagon and glucagon-like peptide 1 receptor (GLP-1R) agonist with anti-obesity effects.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- CAS. Nr.: 3056608-44-4
- Formel: C228H342N56O67
- Molecular Weight:4939.49
-
Speicherung:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biologische Aktivität
Beschreibung
Chemical Information
-
CAS. Nr. 3056608-44-4
-
Molecular Weight 4939.49
-
Formel C228H342N56O67
-
Sequence
His-{Aib}-His-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ala-Lys-Arg-Ala-Gln-Glu-Phe-Ile-Glu-Trp-Leu-Leu-Gln-Ser-Gln-Gln-His-Glu-Ser-Pro-Pro-Pro{Lys(γGlu-C20 diacid)}
-
Sequence Shortening
H-{Aib}-HGTFTSDYSKYLDAKRAQEFIEWLLQSQQHESPPP{K(γGlu-C20 diacid)}
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Please store the product under the recommended conditions in the Certificate of Analysis.
Protokoll
-
Research Protocol for Metabolic Diseases
AMP-activated protein kinase, AMPK, is a conserved cellular energy sensor that responds to reduced cellular energy status and coordinates metabolism by increasing ATP-generating catabolic pathways while suppressing ATP-consuming anabolic processes. In metabolic disease research, the AMPK pathway is experimentally relevant because it regulates hepatic lipid synthesis, fatty acid oxidation, glucose production, skeletal-muscle glucose disposal, mTORC1-linked biosynthesis, autophagy, mitochondrial homeostasis, and whole-body energy balance. The central pathway logic is that energy stress, metformin, exercise-like stimulation, or direct AMPK activators increase AMPKα Thr172 phosphorylation and downstream substrate phosphorylation, including ACC and RAPTOR. Phosphorylation of ACC suppresses lipogenesis and supports fatty acid oxidation, whereas phosphorylation of RAPTOR suppresses mTORC1 signaling and links cellular energy status to growth and protein synthesis control. The pathway is linked
Reinheit & Dokumentation
Verweise
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)