PEP1
Based on 1 Customer Validation
PEP1 is an amphipathic α-helical peptide containing 31 residues. The interaction of PEP1 with POPC-supported lipid bilayers (SLBs) is concentration-dependent: at low concentrations, it inserts into SLBs to generate compressive stress; at medium concentrations, it saturates the membrane surface to maintain constant stress; and at high concentrations, it solubilizes SLBs. PEP1 can be used for research on the mechanism of membrane-peptide interactions.
For research use only. We do not sell to patients.
- Purity: 99.88%
- Formula: C177H259N43O49S
- Molecular Weight:3805.27
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Biological Activity
Description
In Vitro
PEP1 (10-100 μM), a peptide mimicking the wild-type amphipathic helix of HCV NS5A, dose-dependently inhibits the membrane association of wild-type NS5A in an in vitro membrane flotation assay with Huh-7 cell-derived membranes, with maximal inhibition at 100 μM, while having no effect on the membrane association of the control protein VAMP2[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Appearance Solid
-
Molecular Weight 3805.27
-
Formula C177H259N43O49S
-
Color White to off-white
-
Sequence
Ser-Gly-Ser-Trp-Leu-Arg-Asp-Val-Trp-Asp-Trp-Ile-Cys-Thr-Val-Leu-Thr-Asp-Phe-Lys-Thr-Trp-Leu-Gln-Ser-Lys-Leu-Asp-Tyr-Lys-Asp-NH2
-
Sequence Shortening
SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
In Vitro:
DMSO : 50 mg/mL (13.14 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (281 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO | 1 mM | 0.2628 mL | 1.3140 mL | 2.6279 mL | 6.5698 mL |
| 5 mM | 0.0526 mL | 0.2628 mL | 0.5256 mL | 1.3140 mL | |
| 10 mM | 0.0263 mL | 0.1314 mL | 0.2628 mL | 0.6570 mL |