TAT-N24
Based on 1 Customer Validation
TAT-N24 is a cell-penetrating peptide and also an inhibitor of p55PIK. TAT-N24 disrupts the interactions between p55PIK and p53, PCNA or Rb, blocks the p53-dependent ubiquitin-mediated degradation process, and inhibits the nuclear translocation and phosphorylation of NF-κB p65. TAT-N24 enhances MMS-induced p53-dependent cell apoptosis, inhibits DNA synthesis, reduces the expression of Cyclin D1, and induces cell cycle arrest at the G0/G1 or S phase. TAT-N24 inhibits the activation of NLRP3 and NLRC4 inflammasomes, reduces the expression of ZBP1-PANoptosome components, and suppresses PANoptosis. TAT-N24 can be used in research related to leukemia, colon cancer, cervical cancer, liver cancer, corneal neovascularization, restenosis and acute glaucoma.
For research use only. We do not sell to patients.
- Purity : 99.83%
- Formula: C198H313N63O56S3
- Molecular Weight:4568.19
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Biological Activity
Description
|
p55PIK |
p53 |
PCNA |
Rb |
NF-κB |
p65 |
Cyclin D1 |
NLRP3 |
NLRC4 |
In Vitro
TAT-N24 efficiently localizes to the nucleus of HeLa cells[1].
TAT-N24 (50-100 μg/mL; 24-72 h) inhibits the proliferation of HeLa cells in a time- and dose-dependent manner, with significant effects observed at 50 μg/mL and 100 μg/mL after 72 h[1].
TAT-N24 (50-100 μg/mL; 24-72 h) inhibits the proliferation of HepG2 cells in a time- and dose-dependent manner, with significant effects observed at 50 μg/mL and 100 μg/mL after 72 h[1].
TAT-N24 (120 μg/mL; 3 days) induces differentiation of HL60 human leukemia cells into the monocyte lineage, as shown by increased CD11b, CD14, CCL2, CCR, and CD163 expression, and synergizes with ATRA to enhance granulocytic marker expression[3].
TAT-N24 (10-100 μg/mL; 12-36 h) does not induce significant apoptosis in SW480 cells alone, but enhances MMS-induced p53-dependent apoptosis in a dose- and time-dependent manner, with maximum effects seen at ≥50 μg/mL TAT-N24 combined with 200 μM MMS over 36 h[1].
TAT-N24 alone downregulates p53 and p53-dependent apoptosis-related gene expression in SW480 cells, but acts synergistically with MMS to upregulate these genes, consistent with enhanced p53-dependent apoptosis[1].
TAT-N24 does not alter p53-dependent apoptosis-related gene expression in p53-null H1299 cells, either alone or in combination with MMS, confirming its gene-regulatory effects are p53-dependent[1].
TAT-N24 (120 μg/mL; 1-4 days) inhibits proliferation, induces G0/G1 cell cycle arrest, and reduces DNA synthesis in HL60 human leukemia cells when treated at 120 μg/mL for up to 4 days[3].
TAT-N24 (120 μg/mL; 3-48 hours) inhibits proliferation, induces megakaryocytic differentiation, and blocks p55PIK-mediated pro-proliferative signaling in K562 human chronic myeloid leukemia cells, with dose-dependent upregulation of TLR2 and TLR4 at 60-180 μg/mL[3].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. Further protocols information, click here.
-
Cell Line:HeLa cells
-
Concentration:50 μg/mL; 100 μg/mL
-
Incubation Time:24 h; 48 h; 72 h
-
Result:Inhibited cell proliferation in a time- and dose-dependent manner.
Significantly reduced the number of viable cells at 72 h compared to untreated controls.
Reduced colony formation at 50 μg/mL and 100 μg/mL for 72 h.
-
Cell Line:HepG2 cells
-
Concentration:50 μg/mL; 100 μg/mL
-
Incubation Time:24 h; 48 h; 72 h
-
Result:Inhibited cell proliferation in a time- and dose-dependent manner.
Significantly reduced the number of viable cells at 72 h compared to untreated controls.
-
Cell Line:SW480 cells
-
Concentration:10 μg/mL (in combination with 200 μM MMS); 50 μg/mL (in combination with 200 μM MMS); 100 μg/mL (alone); 10-90 μg/mL (in combination with 200 μM MMS); combined with 100, 200, 300 μM MMS
-
Incubation Time:36 h (10 μg/mL + MMS); 12 h, 24 h, 36 h (50 μg/mL + MMS); 36 h (10-90 μg/mL + MMS); 36 h (TAT-N24 + 100, 200, 300 μM MMS)
-
Result:Did not induce significant apoptosis when used alone at 100 μg/mL.
Doubled the apoptosis rate induced by 200 μM MMS at 10 μg/mL.
Achieved maximum enhancement of MMS-induced apoptosis at concentrations ≥50 μg/mL with 200 μM MMS.
Increased synergistic effect on MMS-induced apoptosis over 12-36 h of incubation.
Showed most pronounced enhancement of MMS-induced apoptosis at lower MMS concentrations (100-200 μM).
-
Cell Line:human HL60 leukemia cells
-
Concentration:120 μg/mL
-
Incubation Time:1-4 days (cell counting); 48 h (cell cycle and DNA synthesis assays)
-
Result:Reduced HL60 cell number by 45% compared to the control fusion protein after 4 days.
Induced cell cycle arrest at the G0/G1 transition, with 63.5% of cells in G0/G1 phase (compared to 51.4% in control cells), and decreased the percentage of cells in S phase to 23.7% and G2/M phase to 12.8%.
Reduced DNA synthesis, with only 45.2% of cells testing BrdU-positive (compared to 69.1% in control cells), and reduced BrdU fluorescence intensity to 0.37 times that of control cells.
-
Cell Line:human HL60 leukemia cells
-
Concentration:120 μg/mL
-
Incubation Time:3 days
-
Result:Increased the percentage of CD11b-positive HL60 cells to 26.2% (compared to 5.4% in control fusion protein-treated cells) and increased CD11b mRNA expression by 6.8-fold.
Strongly increased the percentage of CD14-positive cells to 46.5% (compared to 7.3% in control fusion protein-treated cells).
Upregulated mRNA expression of monocyte lineage markers CCL2, CCR, and CD163 by 3.3-, 2.8-, and 4.4-fold, respectively, while only slightly increasing granulocyte marker CD38 mRNA expression (3.1-fold).
When combined with ATRA, synergistically increased CD11b-positive cells to 70.4% (compared to 18.1% with TAT-N24 alone and 31.7% with ATRA alone), but did not further increase CD14-positive cell percentage beyond levels seen with TAT-N24 alone.
In Vivo
TAT-N24 (2 mg per 200 mL lipid emulsion; i.v.; every 2 days; 10-14 days) reduces HL60 leukemia xenograft tumor weight by 54% in athymic nude mice, inhibits tumor cell DNA synthesis, and induces differentiation, with no observed significant toxicity[3].
TAT-N24 (2 mg per 200 mL lipid emulsion; i.v.; every 2 days; 10-14 days) inhibits K562 leukemia xenograft growth and induces tumor cell differentiation via upregulation of TLR2 and TLR4 in athymic nude mice[3].
TAT-N24 (10 mg; local application via pluronic gel; single dose; immediately post-injury) reduces balloon injury-induced neointimal formation and VSMC proliferation in Rattus norvegicus carotid arteries[4].
TAT-N24 (2 μg; intravitreal; single injection) protects retinal ganglion cells from acute glaucoma-induced death by inhibiting ZBP1-PANoptosome-mediated PANoptosis, suppressing NLRP3 and NLRC4 inflammasome activation, reducing microglial activation, and attenuating pyroptosis, apoptosis, and necroptosis[5].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Sprague-Dawley (female, 8-12 weeks old, 180-200 g, corneal suture model)[2]
-
Dosage:0.9%
-
Administration:topical; six times daily; 7 consecutive days
-
Result:Reduced corneal neovascularization area scores and grade scores on days 3 and 7 compared to untreated models.
Decreased corneal inflammatory cell infiltration and neovascularization on days 3 and 7.
Lowered fluorescence intensity of HIF-1α and NF-κB p65 in corneal tissue on days 3 and 7.
Reduced mRNA levels of HIF-1α, VEGF-A, NF-κB p65, TNF-α, IL-1β, and IL-6 in treated corneal tissue on days 3 and 7.
Decreased protein levels of HIF-1α and NF-κB p65 in treated corneal tissue compared to untreated models.
-
Animal Model:Athymic nude (male, 8-10 weeks old, 22-24 g, HL60 cell subcutaneous xenograft)[3]
-
Dosage:2 mg per 200 mL lipid emulsion
-
Administration:i.v.; every 2 days; 10-14 days
-
Result:Reduced mean xenograft tumor weight by 54% compared to the control fusion protein.
Decreased DNA synthesis in tumor xenografts.
Induced expression of the differentiation marker Cd11b in tumor tissue.
Caused no significant changes in mouse appearance, weight, serum glucose levels, or hepatic enzyme activities.
-
Animal Model:Athymic nude (male, 8-10 weeks old, 22-24 g, K562 cell subcutaneous xenograft)[3]
-
Dosage:2 mg per 200 mL lipid emulsion
-
Administration:i.v.; every 2 days; 10-14 days
-
Result:Inhibited growth of K562 tumor xenografts.
Induced expression of the differentiation markers TLR2 and TLR4 in tumor tissue.
-
Animal Model:Sprague-Dawley (adult male, 250-300 g, balloon dilation injury of left common carotid artery)[4]
-
Dosage:10 mg
-
Administration:local application via pluronic gel; single dose; immediately post-injury
-
Result:Reduced neointimal formation, decreasing the intima-to-media ratio and intimal area relative to control.
Reduced the number of PCNA-positive cells (a marker of VSMC proliferation).
-
Animal Model:C57BL/6 (adult female, 6-8 weeks old, acute ocular hypertension-induced acute glaucoma model)[5]
-
Dosage:2 μg
-
Administration:intravitreal; single injection
-
Result:Mitigated reductions in ganglion cell layer and overall retinal thickness caused by acute ocular hypertension injury.
Preserved the number of retinal ganglion cells identified by Brn3a and RBPMS staining.
Reduced retinal apoptotic cell count measured by TUNEL staining.
Decreased acute ocular hypertension-induced upregulation of pyroptosis-associated proteins (NLRP3, NLRC4, ASC, GSDMD, Caspase-1, IL-1β) and GSDMD mRNA.
Inhibited microglial activation measured by Iba1-positive staining intensity.
Attenuated acute ocular hypertension-induced changes in apoptosis-associated markers (decreased Bcl-2/Bax ratio, elevated cleaved-Caspase-3).
Suppressed acute ocular hypertension-induced upregulation of necroptosis-associated molecules (RIPK1, RIPK3, MLKL mRNA and protein, phosphorylated RIPK1, RIPK3, MLKL).
Reduced acute ocular hypertension-induced upregulation of ZBP1-PANoptosome components (ZBP1, Caspase-8 mRNA and protein, RIPK1, RIPK3).
Chemical Information
-
Appearance Solid
-
Molecular Weight 4568.19
-
Formula C198H313N63O56S3
-
Sequence
Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Met-Asp-Arg-Asp-Asp-Ala-Asp-Trp-Arg-Glu-Val-Met-Met-Pro-Tyr-Ser-Thr-Glu-Leu-Ile-Phe-Tyr-Ile-Glu
-
Sequence Shortening
YGRKKRRQRRRMDRDDADWREVMMPYSTELIFYIE
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
In Vitro:
H2O : 25 mg/mL (5.47 mM; Need ultrasonic)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Protocols
-
Western Blot
Western blotting (WB) is a commonly used experimental method in molecular biology, biochemistry, and immunogenetics for identifying and quantifying target proteins. It combines gel electrophoresis with immunoassay, enabling researchers to analyze protein expression, post-translational modifications, and molecular weight.
-
RNA extraction experimental
By lysing cells, releasing RNA, and removing impurities such as proteins and DNA, high-purity RNA products are finally obtained. The commonly used traditional method is the guanidine isothiocyanate/phenol/chloroform method (Trizol), which is suitable for a variety of animal materials including animal tissues, microorganisms, cultured cells, etc., and most plant materials.
-
Annexin V plus membrane-impermeant dye apoptosis staining
Annexin V-based apoptosis assays rely on the detection of phosphatidylserine (PS) externalization from the inner leaflet of the plasma membrane to the outer leaflet, an early biochemical hallmark of apoptosis. Fluorescently labeled Annexin V binds PS in a calcium-dependent manner, enabling identification of early apoptotic cells by flow cytometry or fluorescence microscopy. When combined with a membrane-impermeant DNA-binding dye (e. g. , propidium iodide), this approach allows discrimination between viable (Annexin V−/dye−), early apoptotic (Annexin V+/dye−), and late apoptotic or necrotic (Annexin V+/dye+) cell populations by assessing membrane integrity and PS exposure.
-
BrdU Incorporation Assay
Bromodeoxyuridine (BrdU) incorporation assay is based on the principle that BrdU, a thymidine analog, is incorporated into newly synthesized DNA during the S phase of the cell cycle, thereby serving as a marker of DNA replication and cellular proliferation. Incorporated BrdU can be detected using anti-BrdU antibodies following DNA denaturation, enabling visualization or quantification of proliferating cells through immunochemical detection methods such as immunofluorescence or immunohistochemistry.
-
Protocol for Cell Cycle
Cell-cycle analysis by flow cytometry measures DNA content in single cells to estimate the fraction of cells in G0/G1, S, and G2/M phases. Propidium iodide intercalates into DNA, and after RNA removal with RNase, fluorescence intensity reflects cellular DNA content: 2N cells are assigned to G0/G1, cells between 2N and 4N to S phase, and 4N cells to G2/M. DNA-content analysis alone cannot reliably separate G0 from G1 or G2 from M. Ki-67 can distinguish quiescent G0 cells from cycling cells, EdU or BrdU incorporation marks active DNA synthesis in S phase, and phospho-histone H3 staining identifies mitotic cells within the 4N population.
-
Research Protocol for Inflammation-related Diseases
The NLRP3 inflammasome is a cytosolic innate immune signaling platform that integrates priming signals and danger-signal activation to promote caspase-1 activation, maturation of IL-1β and IL-18, and gasdermin D-mediated pyroptotic cell death. The core experimental logic is to determine whether inflammatory disease phenotypes are driven by increased NLRP3 expression, ASC-containing inflammasome assembly, caspase-1 cleavage, GSDMD cleavage, and extracellular release of IL-1β/IL-18 rather than by nonspecific cell injury alone. The pathway is strongly linked to inflammation-related disease phenotypes because monosodium urate crystals activate NALP3/NLRP3 inflammasome signaling in gout-like crystal inflammation, cholesterol crystals activate NLRP3 inflammasomes in atherogenesis models, and DSS-induced intestinal inflammation has been reported to involve NLRP3 inflammasome activity. However, experimental colitis studies also show context-dependent protective effects of NLRP3 inflammasome co
-
Liver Cancer Modeling
Liver cancer can be classified into primary liver cancer and secondary liver cancer. Secondary liver cancer is the metastatic liver cancer. Primary liver cancer includes hepatocellular carcinoma (HCC), intrahepatic cholangiocarcinoma (ICC) and fibrolamellar HCC, of which HCC is the most common form, accounting for approximately 90% of primary liver cancers[1]. HCC mouse models include chemical agent-induced models, transplanted tumor models, and genetic engineered models.
-
Kinase activity and phosphorylation assays
Kinase activity assays measure the ability of kinases to transfer phosphate groups from ATP to specific substrates, while phosphorylation assays detect the presence and levels of phosphorylated proteins. Common methods include radiolabeled ATP incorporation (e. g. ,), ADP release detection via bioluminescence (e. g. ,[3]), enzyme-linked immunosorbent assays (ELISA) for phospho-specific epitopes (e. g. ,[6]), and microtiter-based formats for high-throughput screening (e. g. ,[8]). The ADP-Glo assay quantifies kinase activity by measuring ADP produced during phosphorylation using a luciferase-based system. Radiometric assays involve autoradiography or scintillation counting after incorporation of 32P-labeled ATP into substrate proteins. ELISA-based approaches rely on phospho-specific antibodies to detect activated kinases in cell lysates or purified samples.
-
Cytoplasmic-Nuclear Fractionated Protein Extraction
Cytoplasmic-nuclear fractionated protein extraction separates soluble cytoplasmic proteins from nuclear-enriched proteins by mild plasma-membrane permeabilization, differential centrifugation, washing of nuclei, and extraction of nuclear proteins for downstream immunoblotting or related molecular analysis. The readout is the relative abundance of a protein in cytoplasmic and nuclear fractions, commonly assessed by western blotting together with compartment markers such as tubulin or pyruvate kinase for cytoplasm and lamin, nucleoporin, hnRNP, H2AX, or Lamin B for nuclear fractions.
-
EdU Incorporation Assay (Click Chemistry-Based DNA Synthesis Measurement)
The EdU incorporation assay measures DNA synthesis by adding the thymidine analog 5-ethynyl-2′-deoxyuridine to cells or tissues, where it is incorporated into newly synthesized DNA during S phase. Incorporated EdU is detected by copper-catalyzed azide-alkyne cycloaddition, in which a fluorescent azide covalently reacts with the ethynyl group on EdU, allowing S-phase cells to be detected by fluorescence microscopy, flow cytometry, or high-content imaging. EdU detection does not require DNA denaturation or anti-BrdU antibody access, which preserves sample structure and improves compatibility with immunostaining and multiparameter cytometry compared with BrdU-based detection. EdU can be cytotoxic in a cell-type- and exposure-dependent manner, so pulse duration, concentration, and continuous-labeling designs should be validated for each cell type.
-
Apoptosis
Apoptosis, also called programmed cell death, is generally characterized by distinct morphological characteristics.
-
TUNEL staining for apoptotic DNA fragmentation
TUNEL staining detects DNA strand breaks by using terminal deoxynucleotidyl transferase to add labeled nucleotides to exposed 3′-OH DNA termini, generating either microscopic staining in fixed cells or tissue sections, or fluorescence/cytometric signal in cell suspensions. TUNEL positivity reflects DNA fragmentation but should not be interpreted alone as definitive apoptosis, because TUNEL can also label necrotic, autolytic, mechanically damaged, or DNA-repair-associated DNA breaks.
-
PCNA Immunodetection Proliferation Assay
PCNA immunodetection measures proliferative activity by detecting proliferating cell nuclear antigen, a nuclear protein associated with DNA polymerase δ function and DNA replication. The assay readout is the proportion of PCNA-positive nuclei among total counted cells, but PCNA labeling is not identical to BrdU labeling because PCNA can mark late G1/early S-associated replication competence and may persist beyond active DNA synthesis depending on fixation and extraction conditions.
-
Flow cytometric DNA-content cell-cycle staining
Flow cytometric DNA-content cell-cycle staining measures the fluorescence intensity of DNA-bound fluorochromes in single cells or nuclei to estimate DNA content distributions, allowing assignment of populations to G0/G1, S, and G2/M phases by DNA histogram deconvolution. Propidium iodide (PI) intercalates into DNA, and PI fluorescence is proportional to cellular DNA content when staining is performed under conditions that make DNA accessible and minimize non-DNA signal. Cells with G2/M DNA content are expected to show approximately twice the fluorescence intensity of G0/G1 cells, while S-phase cells occupy intermediate fluorescence values. PI-based DNA-content analysis can also detect cells with fractional DNA content, often reported as sub-G1, when DNA fragmentation and extraction during staining reduce retained DNA signal in apoptotic cells. DAPI is an alternative DNA fluorochrome for univariate DNA-content analysis, while bivariate approaches combining DNA content with proliferation
-
Apoptosis Solutions
Apoptosis is a regulated, generally non-lytic cell-death pathway that removes unwanted, damaged, infected, or abnormal cells through coordinated morphological changes, caspase activation, DNA fragmentation, and membrane remodeling. The intrinsic apoptosis pathway is controlled mainly by mitochondrial outer membrane permeabilization, BCL-2 family proteins, cytochrome c release, apoptosome formation, caspase-9 activation, and downstream executioner caspase-3/7 activation. The extrinsic apoptosis pathway is initiated by death receptors such as Fas, TNFR, and TRAIL receptors, which recruit adaptor proteins and activate caspase-8 before engaging executioner caspases or mitochondrial amplification through BID cleavage. Apoptosis is linked to many phenotypes, including cancer cell killing, tissue homeostasis, immune regulation, neurodegeneration, infection response, and treatment-induced cytotoxicity; unresolved questions include how apoptosis interacts with necroptosis, pyroptosis, ferroptos
-
Protocol for Kinase activity and phosphorylation assays
Kinase activity assays measure transfer of phosphate from ATP to a protein or peptide substrate, generating phosphorylated substrate, ADP, or incorporated radiolabeled phosphate as the readout; phosphorylation assays measure site-specific phosphorylation in cells or tissues as a proxy for kinase-pathway activation, inhibition, or substrate regulation. Phosphorylation can be detected by phospho-specific Western blot, immunoprecipitation kinase assay, phospho-immunofluorescence, phospho-flow cytometry, luminescent ADP detection, radiolabeled ATP incorporation, or reporter-based pathway assays, and these readouts can be applied to cancer cells, primary neurons, mouse tumors, organoids, inflammatory macrophages, ferroptosis studies, and mitophagy studies when the kinase target is biologically relevant.
Purity & Documentation
References
[2]. Huang J, et al. A cell-permeable peptide inhibitor of p55PIK signaling alleviates suture-induced corneal neovascularization and inflammation. Heliyon. 2023 Apr;9(4):e14869. [Content Brief]
[5]. Li F, et al. TAT-N24 enhances retinal ganglion cell survival by suppressing ZBP1-PANoptosome-mediated PANoptosis in an acute glaucoma mouse model. Experimental eye research. 2025 Feb;251:110244. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O | 1 mM | 0.2189 mL | 1.0945 mL | 2.1891 mL | 5.4726 mL |
| 5 mM | 0.0438 mL | 0.2189 mL | 0.4378 mL | 1.0945 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.