Aam-KTX
Aam-KTX is a Kv channel inhibitor with IC50 values of 1.1 nM and >750 nM for Kv1.3 and Kv1.1, respectively. Aam-KTX is a toxic peptide obtained from the venom of the scorpion Mesobuthus eupeus. Aam-KTX has potential in autoimmune diseases research.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- Formule: C174H288N58O48S7
- Masse moléculaire:4184.96
-
Stockage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Activité biologique
-
Chemical Information
- Pureté et documentation
- Références
-
Help & FAQs
Activité biologique
IC50: 1.1 nM (Kv1.3), ＞750 nM (Kv1.1)[1].
Chemical Information
-
Masse moléculaire 4184.96
-
Formule C174H288N58O48S7
-
Sequence
Gly-Val-Glu-Ile-Asn-Val-Lys-Cys-Thr-Gly-Ser-His-Gln-Cys-Ile-Lys-Pro-Cys-Lys-Asp-Ala-Gly-Met-Arg-Phe-Gly-Lys-Cys-Ile-Asn-Arg-Lys-Cys-His-Cys-Thr-Pro-Lys-NH2 (Disulfide bridge:Cys8-Cys28;Cys14-Cys33;Cys18-Cys35)
-
Sequence Shortening
GVEINVKCTGSHQCIKPCKDAGMRFGKCINRKCHCTPK-NH2 (Disulfide bridge:Cys8-Cys28;Cys14-Cys33;Cys18-Cys35)
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Please store the product under the recommended conditions in the Certificate of Analysis.
Pureté et documentation
Références
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Aam-KTX Related Classifications
HY-P5853 Related Classifications
Powered by Bioz