Corza6
Based on 1 Customer Validation
Corza6 is a potent and selective human voltage-gated proton channel (hHv1) peptide inhibitor. Corza6 binds to the external voltage sensor domain (VSD) loop in hHv1 with a Kd of ~1 nM at the natural, hyperpolarized resting membrane potential (RMP) of mammalian cells. Corza6 allows capacitation in sperm and permits sustained reactive oxygen species (ROS) production in white blood cells (WBCs).
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- Pureté: 97.63%
- Formule: C203H293N55O61S7
- Masse moléculaire:4704.29
-
Stockage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Activité biologique
Description
Chemical Information
-
Appearance Solid
-
Masse moléculaire 4704.29
-
Formule C203H293N55O61S7
-
Color White to off-white
-
Sequence
Ser-Ser-Thr-Cys-Ile-Pro-Ser-Gly-Gln-Pro-Cys-Ala-Asp-Ser-Asp-Asp-Cys-Cys-Glu-Thr-Phe-His-Cys-Lys-Trp-Val-Phe-Phe-Thr-Ser-Lys-Phe-Met-Cys-Arg-Arg-Val-Trp-Gly-Lys-Asp (Disulfide bridge:Cys4-Cys18;Cys11-Cys23;Cys17-Cys34)
-
Sequence Shortening
SSTCIPSGQPCADSDDCCETFHCKWVFFTSKFMCRRVWGKD (Disulfide bridge:Cys4-Cys18;Cys11-Cys23;Cys17-Cys34)
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvant et solubilité
In Vitro:
H2O : 5 mg/mL (1.06 mM; Need ultrasonic)
DMSO : 1 mg/mL (0.21 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Pureté et documentation
-
Fiche technique (296 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Instruction de manipulation (2659 KB)
Références
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O | 1 mM | 0.2126 mL | 1.0629 mL | 2.1257 mL | 5.3143 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.