Linvixdutide
Linvixdutide is a glucagon and glucagon-like peptide 1 receptor (GLP-1R) agonist with anti-obesity effects.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- CAS No.: 3056608-44-4
- Formule: C228H342N56O67
- Masse moléculaire:4939.49
-
Stockage:
Please store the product under the recommended conditions in the Certificate of Analysis.
Activité biologique
Description
Chemical Information
-
CAS No. 3056608-44-4
-
Masse moléculaire 4939.49
-
Formule C228H342N56O67
-
Sequence
His-{Aib}-His-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ala-Lys-Arg-Ala-Gln-Glu-Phe-Ile-Glu-Trp-Leu-Leu-Gln-Ser-Gln-Gln-His-Glu-Ser-Pro-Pro-Pro{Lys(γGlu-C20 diacid)}
-
Sequence Shortening
H-{Aib}-HGTFTSDYSKYLDAKRAQEFIEWLLQSQQHESPPP{K(γGlu-C20 diacid)}
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Please store the product under the recommended conditions in the Certificate of Analysis.
Protocole
-
Research Protocol for Metabolic Diseases
AMP-activated protein kinase, AMPK, is a conserved cellular energy sensor that responds to reduced cellular energy status and coordinates metabolism by increasing ATP-generating catabolic pathways while suppressing ATP-consuming anabolic processes. In metabolic disease research, the AMPK pathway is experimentally relevant because it regulates hepatic lipid synthesis, fatty acid oxidation, glucose production, skeletal-muscle glucose disposal, mTORC1-linked biosynthesis, autophagy, mitochondrial homeostasis, and whole-body energy balance. The central pathway logic is that energy stress, metformin, exercise-like stimulation, or direct AMPK activators increase AMPKα Thr172 phosphorylation and downstream substrate phosphorylation, including ACC and RAPTOR. Phosphorylation of ACC suppresses lipogenesis and supports fatty acid oxidation, whereas phosphorylation of RAPTOR suppresses mTORC1 signaling and links cellular energy status to growth and protein synthesis control. The pathway is linked
Pureté et documentation
Références
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)