79495-86-6
Chemical Structure
β-Endorphin, equine
- CAS No.: 79495-86-6
- Formula:C154H248N42O44S
- Molecular Weight:3423.94
SMILES: [YGGFMSSEKSQTPLVTLFKNAIIKNAHKKGQ]
Biological Activity: β-Endorphin, equine is an endogenous opioid peptide, which binds at high affinity to both μ/δ opioid receptors[1][2]. Analgesic properties[2].
| Cat. No. | Product Name | Purity | Description | Pricing | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
β-Endorphin, equine | β-Endorphin, equine is an endogenous opioid peptide, which binds at high affinity to both μ/δ opioid receptors. Analgesic properties. | |||||||||||||||||||||
|
loading...
/
|
|||||||||||||||||||||||
- [1]. Yahav Dikshtein, et al. β-Endorphin via the Delta Opioid Receptor is a Major Factor in the Incubation of Cocaine Craving. Neuropsychopharmacology. 2013 Nov; 38(12): 2508-2514.
- [2]. Niinistö KE, et al. Plasma levels of heat shock protein 72 (HSP72) and beta-endorphin as indicators of stress, pain and prognosis in horses with colic. Vet J. 2010 Apr;184(1):100-4. [Content Brief]
Keywords