Copeptin (rat)
Based on 1 Customer Validation
Copeptin (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development.
For research use only. We do not sell to patients.
- Purity: 99.97%
- CAS No.: 86280-64-0
- Formula: C183H307N57O61
- Molecular Weight:4281.74
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Biological Activity
Chemical Information
-
CAS No. 86280-64-0
-
Appearance Solid
-
Molecular Weight 4281.74
-
Formula C183H307N57O61
-
Color White to off-white
-
Sequence
Ala-Arg-Glu-Gln-Ser-Asn-Ala-Thr-Gln-Leu-Asp-Gly-Pro-Ala-Arg-Glu-Leu-Leu-Leu-Arg-Leu-Val-Gln-Leu-Ala-Gly-Thr-Gln-Glu-Ser-Val-Asp-Ser-Ala-Lys-Pro-Arg-Val-Tyr
-
Sequence Shortening
AREQSNATQLDGPARELLLRLVQLAGTQESVDSAKPRVY
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
H2O : ≥ 100 mg/mL (23.35 mM)
* "≥" means soluble, but saturation unknown.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (267 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O | 1 mM | 0.2335 mL | 1.1677 mL | 2.3355 mL | 5.8387 mL |
| 5 mM | 0.0467 mL | 0.2335 mL | 0.4671 mL | 1.1677 mL | |
| 10 mM | 0.0234 mL | 0.1168 mL | 0.2335 mL | 0.5839 mL | |
| 15 mM | 0.0156 mL | 0.0778 mL | 0.1557 mL | 0.3892 mL | |
| 20 mM | 0.0117 mL | 0.0584 mL | 0.1168 mL | 0.2919 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.