Copy Link Print Information

IL-8/CXCL8 Protein, Human

7 Cited Publications
Customer Review

Based on 7 publication(s) in Google Scholar

Interleukin-8 (IL-8), also known as CXCL8 or NAP-1, is a pro-inflammatory CXC chemokine. IL-8 acts on human neutrophils via two receptors, CXCR1 and CXCR2. IL-8 has a conserved Glu-Leu-Arg (ELR) N-terminal motif, and is an agonist for CXCR1/CXCR2. IL-8 is produced by various cells including leukocytes, endothelial cells, and epithelial cells. IL-8/CXCL8 Protein, Human is produced in E.coil.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-8/CXCL8 Protein, Human
  • Experimental Validation Results for IL-8/CXCL8 Protein, Human
  • Experimental Validation Results for IL-8/CXCL8 Protein, Human
  • Experimental Validation Results for IL-8/CXCL8 Protein, Human
  • Experimental Validation Results for IL-8/CXCL8 Protein, Human
  • Experimental Validation Results for IL-8/CXCL8 Protein, Human
  • Experimental Validation Results for IL-8/CXCL8 Protein, Human
  • Experimental Validation Results for IL-8/CXCL8 Protein, Human
  • Experimental Validation Results for IL-8/CXCL8 Protein, Human
  • Experimental Validation Results for IL-8/CXCL8 Protein, Human
  • IL-8/CXCL8 Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Interleukin-8 (IL-8), also known as CXCL8 or NAP-1, is a pro-inflammatory CXC chemokine. IL-8 acts on human neutrophils via two receptors, CXCR1 and CXCR2. IL-8 has a conserved Glu-Leu-Arg (ELR) N-terminal motif, and is an agonist for CXCR1/CXCR2. IL-8 is produced by various cells including leukocytes, endothelial cells, and epithelial cells[1][2][3]. IL-8/CXCL8 Protein, Human is produced in E.coil.

Background

IL-8 (CXCL8) belongs to the ELR+ CXC chemokines family. IL-8 is initially produced as a protein of 99 amino acids that undergoes cleavage to form active IL-8 isoforms, a 77 amino acid peptide in non-immune cells or a 72 amino acid peptide in monocytes and macrophages. The gene encoding IL-8 is located on chromosome 4q13-q21. Dimerisation of IL-8 forms the structural basis for receptor binding. IL-8 is expressed by various cells including monocytes, macrophages, leukocytes, endothelial cells, and epithelial cells[1][2][3].
Mature human IL-8/CXCL8 shares 75% amino acid sequence identity with canine IL-8/CXCL8. While, human IL-8 shares 94.95% aa sequence identity with Rhesus Macaque IL-8 protein.
IL-8 is responsible for the recruitment and activation of neutrophils and granulocytes to the site of inflammation. IL-8 is almost undetectable in physiological states, but is rapidly induced by pro-inflammatory cytokines such as TNFα and IL-1β. The function of IL-8 mainly relies on its interaction with specific cell surface GPCR, CXCR1 and CXCR2. In addition, IL-8 is reported to promote integrin β3 upregulation and the invasion of hepatocellular carcinoma cells through activation of the PI3K/Akt pathway. In odontogenic lesions, IL-8 has been proven to be highly expressed in ameloblastoma epithelial cells and irreversible pulpitis. In rheumatoid arthritis and other inflammatory joint diseases IL-8 could bring about the accumulation of neutrophils, which are considered a major source of cartilage-degrading enzymes. IL-8 stimulates the MAPK and tyrosine phosphorylation of cellular proteins. Tumour cells and fibroblasts communicate with each other, including autocrine and paracrine factors, including IL-8, resulting in the upregulation of MMP2 and MMP9 degradable extracellular matrix (ECM) components that trigger tumour invasion[1][2][3][4].
  IL-8 is typically known to promote angiogenesis, but it also activates matrix metalloproteinase (MMP) that is involved in metastasisrelated tissue remodelling. IL-8 is induced in lipopolysaccharide (LPS)-stimulated monocytes and shown to induce neutrophil migration. IL-8 exerts multiple effects on biological activities of tumour cells including proliferation, invasion and migration. IL-8 also increases the expression of Akt in androgen-independent prostate cancer (AIPC) cell lines. IL-8 activates MAPK signalling via PI3K in neutrophils, and via transactivation of EGFR resulting in Ras-GTPase activation in ovarian and lung cancer cell lines. There is substantial amount of experimental data suggesting that IL-8 and receptors contribute to elimination of pathogens, but may also contribute significantly to disease-associated processes, including tissue injury, fibrosis, angiogenesis and tumorigenesis[3][5].

In Vitro

Recombinant human IL-8/CXCL8 (100 ng/mL; for 24-96 h) stimulation leads to enhancement of invasion and suppression of late stage apoptosis in MG-63 cells. Moreover, secretions of MMPs by MG-63 cells are also increased upon stimulation. CXCL8 induces the elevations of phosphorylated PI3K and Akt, but not PKC or FAK[6].

In Vivo

Recombinant human IL-8 (10, 30, and 100 μg/kg; single intravenous injection) injected into rhesus monkeys (2-3 years; 2.5-4.5 kg). IL-8 injection results in instant neutropenia that was due to pulmonary sequestration. Within 30 minutes after IL-8 injection, neutrophilia developed with counts up to 10-fold greater than baseline levels. The numbers of hematopoietic progenitor cells (HPCs) increased of blood at 30 minutes after injection of 100 μg/kg IL-8[7].

Verified Bioactivity

1.The ED50 is <150 ng/mL as measured by CHO-K1/Gα15/hCXCR1 cells (human Gα15 and human CXCR1 stably expressed in CHO-K1 cells).
2.Immobilized Human IL-8 at 2 μg/mL (100 μL/well) can bind Anti-IL-8 Antibody. The ED50 for this effect is 20-50 ng/mL.
3.Loaded Eltrekibart (HY-P990737) on AHC2 biosensor, can bind IL-8/CXCL8 Protein, Human with an affinity constant of <1.000E-11 M as determined in BLI assay.
4.Loaded Adakitug (HY-P990598) on AHC2 biosensor, can bind IL-8/CXCL8 Protein, Human with an affinity constant of <1.0E-11 M as determined in BLI assay.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P10145 (A23-S99)

  • Gene ID
    3576  [NCBI]
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CXCL8; Lung Giant Cell Carcinoma-Derived Chemotactic Protein; Prev. IL8; Alveolar Macrophage Chemotactic Factor I; MDNCF; Tumor Necrosis Factor-Induced Gene 1; NAP-1; Neutrophil-Activating Peptide 1; MONAP; T-Cell Chemotactic Factor; GCP-1; Interleukin 8; Monocyte-Derived Neutrophil Chemotactic Factor; Interleukin-8; Monocyte-Derived Neutrophil-Activating Peptide; Emoctakin; Granulocyte Chemotactic Protein 1; AMCF-I; Chemokine (C-X-C Motif) Ligand 8; B-ENAP; SCYB8; TSG-1; LYNAP; 3-10C; LUCT; K60; LECT; Small Inducible Cytokine Subfamily B, Member 8; IL-8; Beta-Thromboglobulin-Like Protein; GCP1; Neutrophil-Activating Protein 1; NAP1; C-X-C Motif Chemokine 8; NAF; C-X-C Motif Chemokine; Beta Endothelial Cell-Derived Neutrophil Activating Peptide; Protein 3-10C; C-X-C Motif Chemokine Ligand 8; Lymphocyte Derived Neutrophil Activating Peptide

  • AA Sequence

    AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

  • Predicted Molecular Mass

    8.9 kDa

  • Molecular Weight

    Approximately 9-11 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
3.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. M Baggiolini, et al. Neutrophil-activating peptide-1/interleukin 8, a novel cytokine that activates neutrophils. J Clin Invest. 1989 Oct;84(4):1045-9. [Content Brief]

[2]. Baggiolini M, et al. Neutrophil-activating peptide-1/interleukin 8, a novel cytokine that activates neutrophils. J Clin Invest. 1989 Oct;84(4):1045-9. [Content Brief]

[3]. M Wolf, et al. Granulocyte chemotactic protein 2 acts via both IL-8 receptors, CXCR1 and CXCR2. Eur J Immunol. 1998 Jan;28(1):164-70. [Content Brief]

[4]. Koch AE, et al. Interleukin-8 as a macrophage-derived mediator of angiogenesis. Science. 1992 Dec 11;258(5089):1798-801. [Content Brief]

[5]. Qian Liu, et al. The CXCL8-CXCR1/2 pathways in cancer. Cytokine Growth Factor Rev. 2016 Oct;31:61-71. [Content Brief]

[6]. Jian-Feng Liu, et al. IL-8 Is Upregulated in the Tissue-Derived EVs of Odontogenic Keratocysts. Biomed Res Int. 2022 Jul 30;2022:9453270. [Content Brief]

[7]. Remo C Russo, et al. The CXCL8/IL-8 chemokine family and its receptors in inflammatory diseases. Expert Rev Clin Immunol. 2014 May;10(5):593-619. [Content Brief]

[8]. Hai Jiang, et al. CXCL8 promotes the invasion of human osteosarcoma cells by regulation of PI3K/Akt signaling pathway. APMIS. 2017 Sep;125(9):773-780. [Content Brief]

[9]. L Laterveer, et al. Rapid mobilization of hematopoietic progenitor cells in rhesus monkeys by a single intravenous injection of interleukin-8. Blood. 1996 Jan 15;87(2):781-8. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Immobilized Human IL-8 at 2 μg/mL (100 μL/well) can bind Anti-IL-8 Antibody. The ED50 for this effect is 25.14 ng/mL.

  • 1/16

    MedChemExpress Validation
     Loaded Eltrekibart (HY-P990737) on AHC2 biosensor, can bind IL-8/CXCL8 Protein, Human with an affinity constant of <1.000E-11 M as determined in BLI assay.

  • 1/16

    MedChemExpress Validation
     Loaded Adakitug (HY-P990598) on AHC2 biosensor, can bind IL-8/CXCL8 Protein, Human with an affinity constant of <1.0E-11 M as determined in BLI assay.

  • 1/16

    IL-8/CXCL8 Protein, Human purchased from MedChemExpress. Usage Cited in: J Biomed Sci. 2025 Jan 6;32(1):5. [Abstract]

    Customer Validation
     Western blot was performed to evaluate the expression of EMT marker in SW480 and HT29 cells after treated with IL-8, F. nucleatum and Reparixin.

  • 1/16

    IL-8/CXCL8 Protein, Human purchased from MedChemExpress. Usage Cited in: Cancer Cell Int. 2021 Jul 3;21(1):337. [Abstract]

    Customer Validation
     The clones were dramatically inhibited by Danirixin or Reparixin, while exogenous CXCL8 significantly enhanced the colony formation of PC9GR.

  • 1/16

    IL-8/CXCL8 Protein, Human purchased from MedChemExpress. Usage Cited in: Cancer Cell Int. 2021 Jul 3;21(1):337. [Abstract]

    Customer Validation
     The percentage of CSCs was reduced in the setting of CXCL8-CXCR1/2 loop blockage, and recombinant CXCL8 could reverse the CSCs proportion.

  • 1/16

    IL-8/CXCL8 Protein, Human purchased from MedChemExpress. Usage Cited in: J Cell Mol Med. 2020 Jan;24(2):1588-1598. [Abstract]

    Customer Validation
     The effects of IL-8 (100 ng/mL; 48 h) on the migration ability of ovarian cancer cells illustrated by the monolayer wound healing assay.

  • 1/16

    IL-8/CXCL8 Protein, Human purchased from MedChemExpress. Usage Cited in: J Cell Mol Med. 2020 Jan;24(2):1588-1598. [Abstract]

    Customer Validation
     IL-8 promote the cilia formation of SKOV3 cells and A2780 cells. The images showed the cytoskeleton (red) and nucleus (blue).

  • 1/16

    IL-8/CXCL8 Protein, Human purchased from MedChemExpress. Usage Cited in: J Cell Mol Med. 2020 Jan;24(2):1588-1598. [Abstract]

    Customer Validation
     The effects of IL-8 on the migration ability of ovarian cancer cells illustrated by the Transwell assay. Typical optical images of SKOV3 and A2780 illustrated cell migration at 24 h. The cells crossed through the pores of Transwell chamber were stained by crystal violet, Scale bars = 100 μm.

  • IL-8/CXCL8 Protein, Human Product Image
    1/16
  • Experimental Validation Results for IL-8/CXCL8 Protein, Human
  • Experimental Validation Results for IL-8/CXCL8 Protein, Human
  • Experimental Validation Results for IL-8/CXCL8 Protein, Human
  • Experimental Validation Results for IL-8/CXCL8 Protein, Human
  • Experimental Validation Results for IL-8/CXCL8 Protein, Human
  • Experimental Validation Results for IL-8/CXCL8 Protein, Human
  • Experimental Validation Results for IL-8/CXCL8 Protein, Human
  • Experimental Validation Results for IL-8/CXCL8 Protein, Human
  • Experimental Validation Results for IL-8/CXCL8 Protein, Human
  • Experimental Validation Results for IL-8/CXCL8 Protein, Human
  • IL-8/CXCL8 Protein, Human Product Image

  • IL-8/CXCL8 Protein, Human purchased from MedChemExpress. Usage Cited in: J Biomed Sci. 2025 Jan 6;32(1):5. [Abstract]

    Western blot was performed to evaluate the expression of EMT marker in SW480 and HT29 cells after treated with IL-8, F. nucleatum and Reparixin.

  • IL-8/CXCL8 Protein, Human purchased from MedChemExpress. Usage Cited in: Cancer Cell Int. 2021 Jul 3;21(1):337. [Abstract]

    The clones were dramatically inhibited by Danirixin or Reparixin, while exogenous CXCL8 significantly enhanced the colony formation of PC9GR.

  • IL-8/CXCL8 Protein, Human purchased from MedChemExpress. Usage Cited in: Cancer Cell Int. 2021 Jul 3;21(1):337. [Abstract]

    The percentage of CSCs was reduced in the setting of CXCL8-CXCR1/2 loop blockage, and recombinant CXCL8 could reverse the CSCs proportion.

  • IL-8/CXCL8 Protein, Human purchased from MedChemExpress. Usage Cited in: J Cell Mol Med. 2020 Jan;24(2):1588-1598. [Abstract]

    The effects of IL-8 (100 ng/mL; 48 h) on the migration ability of ovarian cancer cells illustrated by the monolayer wound healing assay.

  • IL-8/CXCL8 Protein, Human purchased from MedChemExpress. Usage Cited in: J Cell Mol Med. 2020 Jan;24(2):1588-1598. [Abstract]

    IL-8 promote the cilia formation of SKOV3 cells and A2780 cells. The images showed the cytoskeleton (red) and nucleus (blue).

  • IL-8/CXCL8 Protein, Human purchased from MedChemExpress. Usage Cited in: J Cell Mol Med. 2020 Jan;24(2):1588-1598. [Abstract]

    The effects of IL-8 on the migration ability of ovarian cancer cells illustrated by the Transwell assay. Typical optical images of SKOV3 and A2780 illustrated cell migration at 24 h. The cells crossed through the pores of Transwell chamber were stained by crystal violet, Scale bars = 100 μm.