KGF/FGF-7 Protein, Mouse
Based on 1 publication(s) in Google Scholar
FGF-7 Protein, Mouse is a potent mitogen that enhances cell proliferation in various organs, including the skin, intestine, breast, liver, and lung.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
FGF-7 Protein, Mouse is a potent mitogen that enhances cell proliferation in various organs, including the skin, intestine, breast, liver, and lung.
Background
Fibroblast growth factor-7 (FGF-7) is a potent mitogen that enhances cell proliferation in various organs, including the skin, intestine, breast, liver, and lung[1]. FGF-7, also known as keratinocyte growth factor, insofar as it displays a unique cell specificity. FGF7 binds to perlecan protein core and that exogenous perlecan efficiently reconstitutes FGF7 mitogenic activity in perlecan-deficient cells[2].
Verified Bioactivity
The ED50 is ≤10 ng/mL as measured by 4MBr-5 cells, corresponding to a specific activity of ≥1 × 105 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Free Radic Biol Med
Theaflavin-3,3'-digallate attenuates chondrocyte senescence via modulating FGF7 and KEAP1/NRF2 signaling pathway. [Abstract]2026 Sep:253:1-17. PMID: 42162842
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
P36363 (C32-T194)
-
Molecular Construction
-
N-term
-
FGF-7 (C32-T194)
Accession # P36363 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
FGF7; HBGF-7; Fibroblast Growth Factor 7; FGF-7; KGF; Fibroblast Growth Factor 7 (Keratinocyte Growth Factor); Keratinocyte Growth Factor; Fibroblast Growth Factor; Heparin-Binding Growth Factor 7; FGF
-
AA Sequence
CNDMSPEQTATSVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNSYNIMEIRTVAVGIVAIKGVESEYYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGIPVKGKKTKKEQKTAHFLPMAIT
-
Predicted Molecular Mass
18.7 kDa
-
Molecular Weight
Approximately 19 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)