PDGF-BB Protein, Mouse
Based on 10 publication(s) in Google Scholar
PDGF-BB Protein, Mouse is an active PDGF isoform, used in cell culture applications.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
PDGF-BB Protein, Mouse is an active PDGF isoform, used in cell culture applications.
Background
Platelet-derived growth factor-BB (PDGF-BB) is primarily secreted from platelet α-granules and is the most active PDGF isoform in bone and other connective tissue as it can bind to all known PDGF receptors. PDGF-BB plays an important role in bone regeneration by inducing mitogenesis, chemotaxis, extracellular matrix formation, and vascularization[1].
Verified Bioactivity
The ED50 is <2.5 ng/mL as measured by 3T3 cells, corresponding to a specific activity of >4 × 105 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Publications (10)
-
Journal Impact Factor
-
Most Recent
-
Adv Sci (Weinh)
Aneurysm Is Restricted by CD34+ Cell-Formed Fibrous Collars Through the PDGFRb-PI3K Axis. [Abstract]2025 Feb;12(7):e2408996. PMID: 39731355
PDGF-BB Protein, Mouse purchased from MedChemExpress. Usage Cited in: Adv Sci (Weinh). 2025 Feb;12(7):e2408996. [Abstract]
PDGFBB (200 ng/mL, 12 h) increased Periostin expression in Pdgfr+/+ and Pdgfra−/− cells, but not in Pdgfrb−/− fibroblasts.
PDGF-BB Protein, Mouse purchased from MedChemExpress. Usage Cited in: Adv Sci (Weinh). 2025 Feb;12(7):e2408996. [Abstract]
PDGFBB (200 ng/mL, 12 h) upregulated Periostin, p-PI3K, and p-AKT in the PDGFRb knockout CD34+ cells.
PDGF-BB Protein, Mouse purchased from MedChemExpress. Usage Cited in: Adv Sci (Weinh). 2025 Feb;12(7):e2408996. [Abstract]
Exogenous and reciprocal endogenous co-immunoprecipitation experiments demonstrated the interaction between PDGFRb and PI3K in CD34+ cells treated with PDGFBB (200 ng/mL, 12 h).
-
Cell Death Dis
USP9X-mediated NRP1 deubiquitination promotes liver fibrosis by activating hepatic stellate cells. [Abstract]2023 Jan 19;14(1):40. PMID: 36653359
PDGF-BB Protein, Mouse purchased from MedChemExpress. Usage Cited in: Cell Death Dis. 2023 Jan 19;14(1):40. [Abstract]
PDGF-BB (20 ng/mL, 72 h), TGF-β1 (5 ng/mL, 72 h), and VEGFA (5 ng/mL, 72 h) upregulated the protein expression of collagen I, α-SMA, and NRP1 in primary HSCs.
-
-
Adv Healthc Mater
Enhanced Vascular Smooth Muscle Cell and Extracellular Matrix Repair Using a Metal-Organic Framework-Based Co-Delivery System for Abdominal Aortic Aneurysm Therapy. [Abstract]2025 Mar;14(6):e2402937. PMID: 39716826 -
Cell Biol Toxicol
PARP1 contributes to intimal hyperplasia by regulating METTL3-mediated m6A methylation of TRAIL. [Abstract]2025 Oct 16;41(1):140. PMID: 41099892
PDGF-BB Protein, Mouse purchased from MedChemExpress. Usage Cited in: Cell Biol Toxicol. 2025 Oct 16;41(1):140. [Abstract]
PDGF-BB (20 ng/ml, 12 h) reversed PJ34-induced cell growth inhibition in vascular smooth muscle cells.
PDGF-BB Protein, Mouse purchased from MedChemExpress. Usage Cited in: Cell Biol Toxicol. 2025 Oct 16;41(1):140. [Abstract]
PDGF-BB (20 ng/ml, 12 h) reversed PJ34-induced cell migration inhibition in vascular smooth muscle cells.
-
Brain Res Bull
PDGF-BB mitigates pericyte injury by activating the PHF19-PRC2 complex via the miR-221/BRCA1 signaling axis in Alzheimer's disease. [Abstract]2026 Apr:237:111819. PMID: 41825614 -
FASEB J
Mettl3-Mediated m6A Methylation of Pdgfrb Regulates the Angiogenesis-Dependent Bone Formation. [Abstract]2026 Apr 30;40(8):e71817. PMID: 41999210 -
Autoimmunity
LncRNA DGCR5/miR-204-5p/SRSF7 axis regulates PDGF-BB-induced proliferation and migration of airway smooth muscle cells with potential role in asthma. [Abstract]2023 Dec;56(1):2193678. PMID: 37066515 -
-
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
P31240 (S82-T190)
-
Molecular Construction
-
N-term
-
PDGF-BB (S82-T190)
Accession # P31240 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PDGFB; Platelet-Derived Growth Factor 2; Prev. SIS; PDGF Subunit B; Platelet-Derived Growth Factor Beta Polypeptide; PDGF2; Platelet-Derived Growth Factor Subunit B; Platelet-Derived Growth Factor, Beta Polypeptide (Oncogene SIS); Platelet-Derived Growth
-
AA Sequence
SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT
-
Molecular Weight
Approximately 13 kDa under reduced (R) conditions, 25 kDa under non reducing (N) conditions, based on SDS-PAGE.
-
Structure/Form
Disulfide-linked homodimer
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 10 mM sodium citrate, pH 3.0.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM sodium citrate, pH 4.0, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)