M65
M65 is a deleted peptide of maxadilan (61 a.a.) with deletion of the residues between positions 24 and 42 and is a specific antagonist of PACAP type 1 receptor that inhibits ANP secretion and can be used for relevant researches.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- CAS No.: 1872440-65-7
- Formule: C205H326N64O61S5
- Masse moléculaire:4823.53
-
Stockage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Activité biologique
-
Chemical Information
- Pureté et documentation
- Références
-
Help & FAQs
Activité biologique
M65 (1 µM) completely blocks the cAMP accumulation stimulated by 100 nM of VIP, and partially inhibits the cAMP accumulation stimulated by 1 nM of maxadilan in rat cortical neurons[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS No. 1872440-65-7
-
Masse moléculaire 4823.53
-
Formule C205H326N64O61S5
-
Sequence
Cys-Asp-Ala-Thr-Cys-Gln-Phe-Arg-Lys-Ala-Ile-Asp-Asp-Cys-Gln-Lys-Gln-Ala-His-His-Ser-Asn-Val-Pro-Gly-Asn-Ser-Val-Phe-Lys-Glu-Cys-Met-Lys-Gln-Lys-Lys-Lys-Glu-Phe-Lys-Ala-NH2 (Disulfide bridge:Cys1-Cys5,Cys14-Cys32)
-
Sequence Shortening
CDATCQFRKAIDDCQKQAHHSNVPGNSVFKECMKQKKKEFKA-NH2 (Disulfide bridge:Cys1-Cys5,Cys14-Cys32)
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Please store the product under the recommended conditions in the Certificate of Analysis.
Pureté et documentation
Références
[1]. Lerner EA, et al. Maxadilan, a PAC1 receptor agonist from sand flies. Peptides. 2007 Sep;28(9):1651-4. [Content Brief]
[2]. Uchida D, et al. Maxadilan is a specific agonist and its deleted peptide (M65) is a specific antagonist for PACAP type 1 receptor. Ann N Y Acad Sci. 1998 Dec 11;865:253-8. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
M65 Related Classifications
HY-P4127 Related Classifications
Powered by Bioz