country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Country or Region:

United States

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Referencia número: HY-P5791

Copy Link Print Information

Haplotoxin-2

Haplotoxin-2 is a peptide toxin that can be isolated from Haplopelma lividum.

Para uso exclusivo en investigación. No vendemos a pacientes.

Fòrmula: C₁₆₁H₂₄₈N₄₆O₄₃S₆
Peso molecular:3708.36

Almacenamiento:

Please store the product under the recommended conditions in the Certificate of Analysis.

Haplotoxin-2 Chemical Structure

Tamaño

Precio

Stock

Cantidad

Amount: USD 0.00

* Seleccione Cantidad antes de agregar artículos.

Use of MCE Products

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Actividad biológica

Descripciòn

Haplotoxin-2 is a peptide toxin that can be isolated from Haplopelma lividum^[1].

Chemical Information

Peso molecular 3708.36
Fòrmula C₁₆₁H₂₄₈N₄₆O₄₃S₆
Sequence

Ala-Cys-Lys-Gly-Leu-Phe-Val-Thr-Cys-Thr-Pro-Gly-Lys-Asp-Glu-Cys-Cys-Pro-Asn-His-Val-Cys-Ser-Ser-Lys-His-Lys-Trp-Cys-Lys-Tyr-Lys-Ile-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys22;Cys16-Cys29)
Sequence Shortening

ACKGLFVTCTPGKDECCPNHVCSSKHKWCKYKI-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys22;Cys16-Cys29)
Envío

Room temperature in continental US; may vary elsewhere.
Almacenamiento

Please store the product under the recommended conditions in the Certificate of Analysis.

Pureza y Documentación

Select Batch:

Pureza: 99.98%

Assay: 99.98%

ee.: 99.98%

Ficha de datos (259 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Instrucciones de manejo (2659 KB)

Referencias

[1]. Zhang YY, et al. Structural and Functional Diversity of Peptide Toxins from Tarantula Haplopelma hainanum (Ornithoctonus hainana) Venom Revealed by Transcriptomic, Peptidomic, and Patch Clamp Approaches. J Biol Chem. 2015 May 29;290(22):14192-207. [Content Brief]

Calculators

Calculadora de molaridad

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Calculadora de dilución

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Bioz

Keywords

MOQ

Minimum order quantity

100 mg

Obtener un presupuesto En stock

Other size

Obtener un presupuesto