1. GPCR/G Protein
  2. Glucagon Receptor
  3. GIP (1-30) amide,Human acetate

GIP (1-30) amide,Human acetate 

Cat. No.: HY-P2080B
Handling Instructions

GIP (1-30) amide,Human acetate is a glucose-dependent insulinotropic polypeptide (GIP) fragment. GIP is an incretin hormone that stimulates insulin secretion and reduces postprandial glycaemic excursions. GIP (1-30) amide (Human) dose-dependently promotes insulin secretion over the range 10-9-10-6 M.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

GIP (1-30) amide,Human acetate Chemical Structure

GIP (1-30) amide,Human acetate Chemical Structure

Size Stock
100 mg   Get quote  
250 mg   Get quote  
500 mg   Get quote  

* Please select Quantity before adding items.

Other Forms of GIP (1-30) amide,Human acetate:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

GIP (1-30) amide,Human acetate is a glucose-dependent insulinotropic polypeptide (GIP) fragment. GIP is an incretin hormone that stimulates insulin secretion and reduces postprandial glycaemic excursions. GIP (1-30) amide (Human) dose-dependently promotes insulin secretion over the range 10-9-10-6 M[1].

In Vitro

The glucose-dependent action of Glucose-dependent insulinotropic polypeptide (GIP) on pancreatic β-cells has attracted attention towards its exploitation as a potential drug for type 2 diabetes. In a 50% aqueous trifluoroethanol solvent, GIP(1-30) amide has an α-helical structural region from F6 to A28. The structures calculated for GIP(1-30) amide remain within one family of conformations and the level of agreement between the structures demonstrated the ordered arrangement[1].

Molecular Weight

3591.99

Formula

C₁₆₄H₂₄₄N₄₀O₄₉S

Sequence

{Tyr}{Ala}{Glu}{Gly}{Thr}{Phe}{Ile}{Ser}{Asp}{Tyr}{Ser}{Ile}{Ala}{Met}{Asp}{Lys}{Ile}{His}{Gln}{Gln}-NH2

Sequence Shortening

YAEGTFISDYSIAMDKIHQQDFVNWLLAQK-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

GIP (1-30) amide,HumanGlucagon ReceptorGCGRGlucose-dependentinsulinotropicpolypeptideGIPdiabetesα-helixInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product name:
GIP (1-30) amide,Human acetate
Cat. No.:
HY-P2080B
Quantity:
MCE Japan Authorized Agent: