human GIP(3-30), amide
Based on 3 publication(s) in Google Scholar
Human GIP(3-30), amide is a high affinity antagonist of the human GIP receptor in vitro. Human GIP(3-30), amide has potential anti-obesity and anti-diabetic effects.
For research use only. We do not sell to patients.
- Purity: 99.76%
- CAS No.: 1884226-05-4
- Formula: C150H226N38O44S
- Molecular Weight:3297.69
-
Storage:
Sealed storage, away from moisture and light.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Purity & Documentation
- References
-
Help & FAQs
Publications Citing Use of MedChemExpress (MCE) human GIP(3-30), amide
More
Biological Activity
Human GIP(3-30), amide (0.01-10 µM, 20 min) competitively binds to GIP receptor (GIPR), blocking GIP-mediated cAMP accumulation (Ki=16.8 nM), β-arrestin recruitment (Ki for β-arrestin-1/2 recruitment is 10.6 nM and 10.2 nM) and receptor internalization[2].
Human GIP(3-30), amide (0.01-10 µM, 30 min) inhibits GIP mediated insulin secretion and signal transduction in adipocytes[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS No. 1884226-05-4
-
Appearance Solid
-
Molecular Weight 3297.69
-
Formula C150H226N38O44S
-
Color White to off-white
-
Sequence
Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH2
-
Sequence Shortening
EGTFISDYSIAMDKIHQQDFVNWLLAQK-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture and light
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Publications (3)
-
Journal Impact Factor
-
Most Recent
-
Pharmacol Res
Tirzepatide, a dual GIP/GLP-1 receptor agonist, attenuates endothelial dysfunction and angiotensin II-induced abdominal aortic aneurysm in ApoE-/- mice. [Abstract]2026 Jun 24:230:108321. PMID: 42342001 -
J Med Chem
Discovery and Preclinical Evaluation of TPM003: A Novel GLP-1/GIP/Glucagon Triple Hormone Receptor Agonist with Robust Efficacy in Obesity and NASH. [Abstract]2026 Feb 26;69(4):4984-5001. PMID: 41640214 -
Solvent & Solubility
DMSO : ≥ 100 mg/mL (30.32 mM; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
* "≥" means soluble, but saturation unknown.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Select the appropriate dissolution method based on your experimental animal and administration route.
- For the following dissolution methods, please ensure to first prepare a clear stock solution using an In Vitro approach and then sequentially add co-solvents:
- To ensure reliable experimental results, the clarified stock solution can be appropriately stored based on storage conditions. As for the working solution for In Vivo experiments, it is recommended to prepare freshly and use it on the same day.
- The percentages shown for the solvents indicate their volumetric ratio in the final prepared solution. If precipitation or phase separation occurs during preparation, heat and/or sonication can be used to aid dissolution.
Please enter the basic information of animal experiments:
-
-
-
-
Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Please enter your animal formula composition:
-
%DMSO +
Recommended: Keep the proportion of DMSO in working solution below 2% if your animal is weak.
-
%+
-
+%Tween-80 + +
-
%Saline +
The co-solvents required include: DMSO, . All of co-solvents are available by MedChemExpress (MCE). , Tween 80. All of co-solvents are available by MedChemExpress (MCE).
Working solution concentration: 0.22 mg/mL
Method for preparing stock solution: mg drug dissolved in μL DMSO. Stock solution concentration: mg/mL. * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
1. Take μL DMSO stock solution;
2. Add μL .
μL , mix evenly;
3. Then add μL Tween 80, mix evenly;
4. Then add μL
Please ensure that the stock solution in the first step is dissolved to a clear state, and add co-solvents in sequence. You can use ultrasonic heating (ultrasonic cleaner, recommended frequency 20-40 kHz), vortexing, etc. to assist dissolution.
Purity & Documentation
-
Data Sheet (280 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Sparre-Ulrich AH, et al. GIP(3-30)NH2 is a potent competitive antagonist of the GIP receptor and effectively inhibits GIP-mediated insulin, glucagon, and somatostatin release. Biochem Pharmacol. 2017;131:78-88. [Content Brief]
[2]. Gabe MBN, et al., Human GIP(3-30)NH2 inhibits G protein-dependent as well as G protein-independent signaling and is selective for the GIP receptor with high-affinity binding to primate but not rodent GIP receptors. Biochem Pharmacol. 2018 Apr;150:97-107. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO | 1 mM | 0.3032 mL | 1.5162 mL | 3.0324 mL | 7.5811 mL |
| 5 mM | 0.0606 mL | 0.3032 mL | 0.6065 mL | 1.5162 mL | |
| 10 mM | 0.0303 mL | 0.1516 mL | 0.3032 mL | 0.7581 mL | |
| 15 mM | 0.0202 mL | 0.1011 mL | 0.2022 mL | 0.5054 mL | |
| 20 mM | 0.0152 mL | 0.0758 mL | 0.1516 mL | 0.3791 mL | |
| 25 mM | 0.0121 mL | 0.0606 mL | 0.1213 mL | 0.3032 mL | |
| 30 mM | 0.0101 mL | 0.0505 mL | 0.1011 mL | 0.2527 mL |
human GIP(3-30), amide Related Classifications
HY-P10138 Related Classifications
Powered by Bioz