human GIP(3-30), amide TFA
Based on 3 publication(s) in Google Scholar
Human GIP(3-30), amide TFA is the TFA salt form of human GIP(3-30), amide (HY-P10138). Human GIP(3-30), amide TFA is a high affinity antagonist of the human GIP receptor in vitro. Human GIP(3-30), amide TFA has potential anti-obesity and anti-diabetic effects.
For research use only. We do not sell to patients.
- Purity: 96.90%
- Formula: C150H226N38O44S.xC2HF3O2
- Molecular Weight:3297.69 (free base)
-
Storage:
Sealed storage, away from moisture and light.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Purity & Documentation
- References
-
Help & FAQs
Publications Citing Use of MedChemExpress (MCE) human GIP(3-30), amide TFA
More
Biological Activity
Human GIP(3-30), amide TFA (0.01-10 µM, 20 min) competitively binds to GIP receptor (GIPR), blocking GIP-mediated cAMP accumulation (Ki=16.8 nM), β-arrestin recruitment (Ki for β-arrestin-1/2 recruitment is 10.6 nM and 10.2 nM) and receptor internalization[2].
Human GIP(3-30), amide TFA (0.01-10 µM, 30 min) inhibits GIP mediated insulin secretion and signal transduction in adipocytes[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Appearance Solid
-
Molecular Weight 3297.69 (free base)
-
Formula C150H226N38O44S.xC2HF3O2
-
Color White to off-white
-
Sequence
Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH2
-
Sequence Shortening
EGTFISDYSIAMDKIHQQDFVNWLLAQK-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture and light
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Publications (3)
-
Journal Impact Factor
-
Most Recent
-
Pharmacol Res
Tirzepatide, a dual GIP/GLP-1 receptor agonist, attenuates endothelial dysfunction and angiotensin II-induced abdominal aortic aneurysm in ApoE-/- mice. [Abstract]2026 Jun 24:230:108321. PMID: 42342001 -
J Med Chem
Discovery and Preclinical Evaluation of TPM003: A Novel GLP-1/GIP/Glucagon Triple Hormone Receptor Agonist with Robust Efficacy in Obesity and NASH. [Abstract]2026 Feb 26;69(4):4984-5001. PMID: 41640214 -
Solvent & Solubility
DMSO : 100 mg/mL (Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Purity & Documentation
-
Data Sheet (280 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
human GIP(3-30), amide TFA Related Classifications
HY-P10138A Related Classifications
Powered by Bioz