1. GPCR/G Protein
    Neuronal Signaling
  2. CGRP Receptor
  3. Calcitonin (salmon)

Calcitonin (salmon) (Synonyms: Salmon calcitonin)

Cat. No.: HY-P0090 Purity: 98.52%
Handling Instructions

Calcitonin salmon, a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Calcitonin (salmon) Chemical Structure

Calcitonin (salmon) Chemical Structure

CAS No. : 47931-85-1

Size Price Stock Quantity
1 mg USD 120 In-stock
Estimated Time of Arrival: December 31
5 mg USD 240 In-stock
Estimated Time of Arrival: December 31
10 mg USD 348 In-stock
Estimated Time of Arrival: December 31
25 mg USD 540 In-stock
Estimated Time of Arrival: December 31
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

Based on 2 publication(s) in Google Scholar

Top Publications Citing Use of Products

Publications Citing Use of MCE Calcitonin (salmon)

    Calcitonin (salmon) purchased from MCE. Usage Cited in: J Cell Mol Med. 2020 Aug;24(15):8650-8661.

    Calcitonin increases phosphorylated PKC-ε but reduces phosphorylated PKC-δ, which are antagonistic to the effects of IL-1 treatment.
    • Biological Activity

    • Protocol

    • Purity & Documentation

    • References

    • Customer Review

    Description

    Calcitonin salmon, a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption.

    IC50 & Target

    Amylin, Calcitonin receptor[1].

    In Vivo

    Oral Calcitonin salmon treatment dose-dependently attenuates fasting and non-fasted hyperglycaemia during the intervention period. At the end of the study period, oral Calcitonin salmon treatment by dose decreases diabetic hyperglycaemia by ~9 mM and reduces HbA1c levels by 1.7%. Furthermore, a pronounced reduction in glucose excursions is dose-dependently observed for oral Calcitonin salmon treatment during oral glucose tolerance test. In addition, oral Calcitonin salmon treatment sustains hyperinsulinaemia and attenuates hyperglucagonaemia and hypersecretion of total glucagon-like peptide-1 predominantly in the basal state. Lastly, oral Calcitonin salmon treatment dose-dependently improves pancreatic beta-cell function and beta-cell area at study end[1].

    MCE has not independently confirmed the accuracy of these methods. They are for reference only.

    Clinical Trial
    Molecular Weight

    3431.85

    Formula

    C₁₄₅H₂₄₀N₄₄O₄₈S₂

    CAS No.

    47931-85-1

    Sequence

    Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bridge: Cys1-Cys7)

    Sequence Shortening

    CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: Cys1-Cys7)

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Storage
    Powder -80°C 2 years
    -20°C 1 year
    In solvent -80°C 6 months
    -20°C 1 month
    Solvent & Solubility
    In Vitro: 

    H2O : 100 mg/mL (29.14 mM; Need ultrasonic)

    Preparing
    Stock Solutions
    Concentration Solvent Mass 1 mg 5 mg 10 mg
    1 mM 0.2914 mL 1.4569 mL 2.9139 mL
    5 mM 0.0583 mL 0.2914 mL 0.5828 mL
    10 mM 0.0291 mL 0.1457 mL 0.2914 mL
    *Please refer to the solubility information to select the appropriate solvent.
    References
    Animal Administration
    [1]

    Rats[1]
    Male ZDF rats are treated with oral Calcitonin salmon (sCT: 0.5, 1.0 or 2 mg/kg) or oral vehicle twice daily from age 8 to 18 weeks. Zucker lean rats serve as control group. Fasting and non-fasted blood glucose, glycosylated haemoglobin (HbA1c) and levels of pancreas and incretin hormones are determined. Oral glucose tolerance test and i.p. glucose tolerance test were compared, and beta-cell area and function were evaluated[1].

    MCE has not independently confirmed the accuracy of these methods. They are for reference only.

    References

    Purity: 98.52%

    • No file chosen (Maximum size is: 1024 Kb)
    • If you have published this work, please enter the PubMed ID.
    • Your name will appear on the site.
    • Molarity Calculator

    • Dilution Calculator

    The molarity calculator equation

    Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

    Mass   Concentration   Volume   Molecular Weight *
    = × ×

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    Keywords:

    Calcitonin (salmon)Salmon calcitoninCGRP ReceptorCalcitonin gene-related peptide receptorInhibitorinhibitorinhibit

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    Product Name

     

    Salutation

    Applicant Name *

     

    Email address *

    Phone number *

     

    Organization name *

    Department *

     

    Requested quantity *

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    Calcitonin (salmon)
    Cat. No.:
    HY-P0090
    Quantity:
    MCE Japan Authorized Agent: