MLH40
MLH40 is a peptide inhibitor with activity against Dengue virus (DENV) infection, which is found in the conserved ectodomain region of DENV membrane protein. MLH40 inhibits DENV through its N-terminal loop interaction with DENV envelope protein and altering the dimer conformation.
연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.
- 화학식: C209H325N61O58S2
- 분자량:4684.32
-
보관:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biological Activity
제품 설명
Chemical Information
-
분자량 4684.32
-
화학식 C209H325N61O58S2
-
Sequence
Ser-Val-Ala-Leu-Val-Pro-His-Val-Gly-Met-Gly-Leu-Glu-Thr-Arg-Thr-Glu-Thr-Trp-Met-Ser-Ser-Glu-Gly-Ala-Trp-Lys-His-Val-Gln-Arg-Ile-Glu-Thr-Trp-Ile-Leu-Arg-His-Pro-Gly
-
Sequence Shortening
SVALVPHVGMGLETRTETWMSSEGAWKHVQRIETWILRHPG
-
선적
Room temperature in continental US; may vary elsewhere.
-
보관
Please store the product under the recommended conditions in the Certificate of Analysis.
Protocol
-
Research Protocol for Infectious Diseases
Infectious-disease experiments test how pathogens interact with host barriers, innate immune receptors, inflammatory signaling, pathogen replication, and tissue injury; pattern-recognition receptors such as TLRs, RIG-I-like receptors, NOD-like receptors, and inflammasomes detect microbial molecules and activate NF-κB, interferon, and cytokine responses. The central hypothesis is that infection severity reflects the balance between pathogen burden and host response: protective inflammation restricts pathogen growth, whereas excessive or mislocalized inflammation contributes to tissue damage and disease phenotype. Unresolved questions include which host pathways are protective versus pathogenic, why some infection models fail to translate to human disease, and which combined readouts best predict clinically relevant infection outcomes.
-
Membrane Protein Extraction Using Detergents and Chaotropes
Membrane protein extraction with detergents and chaotropes solubilizes lipid-bilayer-associated proteins by disrupting protein-lipid and protein-protein interactions while maintaining proteins in a soluble state for downstream electrophoresis, purification, or mass spectrometry. Chaotropes such as urea and thiourea improve solubilization of difficult proteins, while nonionic and zwitterionic detergents such as CHAPS, ASB-14, SB 3-10, MEGA-10, dodecyl maltoside, and Triton X-100 differ in extraction efficiency depending on sample type and membrane protein properties.
순도&문서
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)